SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000047311 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000047311
Domain Number 1 Region: 91-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-24
Family Ras-binding domain, RBD 0.0044
Further Details:      
 
Domain Number 2 Region: 986-1087
Classification Level Classification E-value
Superfamily PDZ domain-like 1.24e-23
Family PDZ domain 0.0000277
Further Details:      
 
Domain Number 3 Region: 277-385
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000104
Family FHA domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000047311   Gene: ENSRNOG00000024456   Transcript: ENSRNOT00000040448
Sequence length 1100
Comment pep:known chromosome:RGSC3.4:12:12426463:12485651:1 gene:ENSRNOG00000024456 transcript:ENSRNOT00000040448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSIFLGLQPSPSHWLKASVVIYEDALTMFYGTQFIMSPPTKNKLKRQSQLLSSMLSRT
LSYKYRDLDSTFCSLGASDDPSELSTQLSAPGVLKVFGDSVCTGTHYKSVLATGASSAQE
LVKEALERYALDPECASQYVLCDVVGQAGDSGQRWQAQCFRVFGDNEKPLLIQELWKPRE
GLSRRFELRKKSDVEELAARDVDTTTAGINAQARRLQRIRAKGATALTSETAQSSPPTGL
RRTVSETSLSPTPTLPEAAQRPEEPLPDSMRYSLYQCPHLLLLQGYNQQHDSLVYVLSRE
RHTVGQRTPSSKPSISLSAPDILPLHCTIRRHQSPDGGPAGTRLVLEPIAGAPVSVNFSE
VGRNPVVLQHGDLLSLGLYYLLLFKDPGQAQPLPACALARLGAAPQSCRMCGAALKARGP
ASLPAAVVRRRSLFLEFEPDVEDTLLQRIMTLIEPGGDDHKLTPAFLLCLCIQHSATHFQ
PGTFRHLLLKIAKRIRDTVWEKTKELAEKQAQLQEPISWASFPMADLVPDLQHILFWMSN
CIELLYFIQQKSPLYVQSMEEELDVTGSKESLFSCTLTASEEAMAALEEVVLYAFQQCVY
YLSKCLYVCLPALLECPPFQTERRESWRSGPALPEELRRVVSVFQATMDLLQQLQMHPEV
ASQMLAYLFFFSGTLLLNQVLDKGPSLSCFHWPRGVQVCARLQQFLEWARSAGLGAPAER
FFRKLSCTLHLLATPRAQLVQMSWATLRATFPALNPAQLHRLLTQYQLASAMGPVSAWDP
GAQESPEAFQTEDILESYENPPPIVLPSQGFQVDLEADCPEDSIYQHLLYIRHFLWGLRG
QASPESGPAQPDSIEGLYHTIPEGHLEGHGCPLTNREQGRGAVETAPGHSLPVPGAPRAQ
GPPGRQPPRGDRRGSQAGSLHTDSSCLLTPPSTPLGLEPGGPTWPEPSGLCGKALLEGQR
NGPGGLPGAVLEGDAVQAAAEPPAEASSPSSSTEDFCYVFMVELERGPSGLGMGLIDGMH
TPLEAPGLYIQTLLPGSPAASDGRLSLGDQILEVNGSSLMGVSYMRAVDLIRHGGKKMRF
LVAKSDMETAKKIRFRKPPS
Download sequence
Identical sequences ENSRNOP00000047311 10116.ENSRNOP00000047311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]