SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000048253 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000048253
Domain Number 1 Region: 175-402
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-48
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 658-754
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-20
Family PDZ domain 0.00000483
Further Details:      
 
Domain Number 3 Region: 540-615
Classification Level Classification E-value
Superfamily SH3-domain 1.29e-18
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 2100-2163
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000529
Family SAM (sterile alpha motif) domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000048253   Gene: ENSRNOG00000019207   Transcript: ENSRNOT00000046418
Sequence length 2167
Comment pep:known chromosome:RGSC3.4:1:94817427:94840584:1 gene:ENSRNOG00000019207 transcript:ENSRNOT00000046418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSPATSEDEERHSASECPEGGSESDSSPDGPGRGPQGTRGRGSGAPGNLASTRGLQGR
SMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLF
QPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGL
KKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHI
DFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELL
LYNRAQLGIADENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTALHICALYNKE
TCARILLYRGANKDVKNNNGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR
RGPPGAGLTVPPALLRANSDTSMALPDWMVFSAPGASSSGTPGPTSGPQGQSQPSAPSTK
LSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPRDGPAGGTGGSGGPGGS
LGSRGRRRKLYSAVPGRSFMAVKSYQAQGEGEISLSKGEKIKVLSIGEGGFWEGQVKGRV
GWFPSDCLEEVANRSQEGRQESRSDKAKRLFRHYTVGSYDSFDAPSLIDGIDSGSDYIIK
EKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGD
FLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVRKKASQQAKRLPPP
AISLRSKSMTSELEEMVSPWKKKIEYEQQPAAVPSMEKKRTVYQMALNKLDEILAAAQQT
ISASESPGPGGLASLGKHRPKGFFATESSFDPHHRSQPSYDRPSFLPPGPGLMLRQKSIG
AAEDDRPYLAPPAMKFSRSLSVPGSEDIPPPPTTSPPEPPYSTPPAPSSSGRLTPSPRGG
PFNPSSGGPLPASSPSSFDGPSPPDTRGGGREKSLYHSAALPPAHHHPPHHHHHHAPPPQ
PHHHHAHPPHPPEMETGGSPDDPPPRLALGPQPSLRGWRGGGPSPTSGAPSPSHHSSSGG
SSGPTQAPALRYFQLPPRAASAAMYVPARSGRGRKGPLVKQTKVEGEPQKGSIPSASSPT
SPALPRSEPPPAGPSEKNSIPIPTIIIKAPSTSSSGRSSQGSSTEAEPPTQPDGAGGGGS
SPSPAPATSPVPPSPSPVPTPASPSGPATLDFTSQFGAALVGAARREGGWQNEARRRSTL
FLSTDAGDEDGGDSGLGPGGPPGPRLRHSKSIDEGMFSAEPYLRLESGGSSGGYGAYAAG
SRAYGGSGSSSAFTSFLPPRPLVHPLTGKALDPASPLGLALAARERALKESSEGGGTPQP
PPRPPSPRYDAPPPTLHHHSPHSPHSPHARHEPVLRLWGDPARRELGYRAGLGSQEKALT
ASPPAARRSLLHRLPPTAPGVGPLLLQLGPEPPTPHPGVSKAWRTAAPEEPERLPLHVRF
LENCQARPPPAGTRGSSTEDGPGVPPPSPRRVLPTSPTSPRGNEENGLPLLVLPPPAPSV
DVDDGEFLFAEPLPPPLEFSNSFEKPESPLTPGPPHPLPDPPSPATPLPAAPPPAVAAAP
PTLDSTASSLTSYDSEVATLTQGAPAAPGDPPAPGPPAPAAPAPPAPQPGPDPPPGTDSG
IEEVDSRSSSDHPLETISSASTLSSLSAEGGGNTGGVAGGGAGVASGTELLDTYVAYLDG
QAFGGSGTPGPPYPPQLMTPSKLRGRALGTSGNLRPGPSGGLRDPVTPTSPTVSVTGAGT
DGLLALSACPGPSTAGVAGGPVAVEPEVPPVPLPAASSLPRKLLPWEEGPGPPPPPLPGP
LSQPQASALATVKASIISELSSKLQQFGGSSTAGGALPWARGGSGGSTDSHHGGASYIPE
RTSSLQRQRLSEDSQTSVLSKPSSSIFQNWPKPPLPPLPTGSGVSSSTAAAPGATSPSAS
SASASTRHLQGVEFEMRPPLLRRAPSPSLLPASDHKVSPAPRPSSLPILPSGPIYPGLFD
IRSSPTGGAGGSTDPFAPVFVPPHPGISGGLGGALSGASRSLSPTRLLSLPPDKPFGAKP
LGFWTKFDVADWLEWLGLSEHRAQFLDHEIDGSHLPALTKEDYVDLGVTRVGHRMNIDRA
LKFFLER
Download sequence
Identical sequences ENSRNOP00000048253 10116.ENSRNOP00000026100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]