SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000049082 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000049082
Domain Number 1 Region: 59-183
Classification Level Classification E-value
Superfamily UBC-like 1.38e-52
Family UBC-related 0.000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000049082   Gene: ENSRNOG00000032690   Transcript: ENSRNOT00000046879
Sequence length 184
Comment pep:known chromosome:RGSC3.4:15:8554876:8827742:1 gene:ENSRNOG00000032690 transcript:ENSRNOT00000046879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKSA
GPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGV
ICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTK
RYAT
Download sequence
Identical sequences 10116.ENSRNOP00000049082 ENSRNOP00000049082 NP_001101841.1.100692 NP_001101841.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]