SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000049099 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000049099
Domain Number 1 Region: 5-276
Classification Level Classification E-value
Superfamily L domain-like 1.05e-52
Family Internalin LRR domain 0.079
Further Details:      
 
Domain Number 2 Region: 239-392
Classification Level Classification E-value
Superfamily L domain-like 1.7e-28
Family Internalin LRR domain 0.03
Further Details:      
 
Domain Number 3 Region: 836-942
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-25
Family PDZ domain 0.0000517
Further Details:      
 
Domain Number 4 Region: 964-1079
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-25
Family PDZ domain 0.0037
Further Details:      
 
Domain Number 5 Region: 1078-1177
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-24
Family PDZ domain 0.0000142
Further Details:      
 
Domain Number 6 Region: 702-799
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-23
Family PDZ domain 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000049099   Gene: ENSRNOG00000032574   Transcript: ENSRNOT00000047338
Sequence length 1663
Comment pep:known chromosome:RGSC3.4:7:114077734:114100397:-1 gene:ENSRNOG00000032574 transcript:ENSRNOT00000047338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPVELG
GLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LTALPRSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVLSLRDNRLAVLPPELAHTAEL
HVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQTEDDAQTGEKVLTCYLLPQQP
LPSLEDPGQQSSPSESCSDAPLSRVSVIQFEDPLEGEEDAEEAAAEKRGLQRRATPHPSE
LKVMKRGIEERRNEAFVCKPDPSPPSPSEEERRLSAESALSGNSVPSASTASDGEPETLP
AEVQGLGQQEAMPGQEEYPEEDYNEPTVHFAEDTLIPREDGEGEEGQPEAPWPLPSGRQR
LIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDREGPTAGWHNGPHTPWAPRAHEEEEE
EENRDEEEGEASMEEDDKEEAVASAPSVKGVSFDQANNLLIEPARIEEEELTLTIVRQTG
GLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAAHAGVRVGDKLLEVNGVALQDAEHHEA
VEALRGAGAAVQMRVWRERMVEPENAVTITPLRPEDDYSPREWRGGGLRLPLLQPETPVP
LRQRHAACLVRSEKGLGFSIAGGKGSTPYRAGDAGIFISRIAEGGAAHRAGTLQVGDRVL
SINGVDMTEARHDHAVSLLTAASTTISLLLERETGGAYPPSPPPHSSSTPTATVAATMTT
AIPGEPLLPRLSPSLLATALEGPYPVEEICLPRAGGPLGLSIVGGSDHSSHPFGVQDPGV
FISKVLPRGLAARCGLRVGDRILAVNGQDVREATHQEAVSALLRPCLELCLLVRRDPPPP
GMRELCIQKAPGEKLGISIRGGAKGHAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVGLR
LLEVNQQSLLGLTHAEAVQLLRSVGDTLTVLVCDGFDTSTTTALEVSPGVIANPFAAGLG
HRNSLESISSIDRELSPEGPGKEKELASQTLPWEPESAETTGRNQEPLKLDYRVLAAVPS
AGSLQRGPCATTGGKMTEAPSSPGSQQTKPGVIQPLAQAWPRDSPAPRGRDGPCSPPSPD
ELPANVKQAYRAFAAVPTVHPPENSATQPPTPGPAASPEQLSFRERQKYFELEVRVPQAE
GPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREEAVTSGPDTGLASDRESLDDEQEAE
QPWAGPSHAGGLSPSSPTPLGGSAPVRTAKAERRHQERLRMQSPELPAPERALSPAERRA
LEAEKRALWRAARMKSLEQDALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLE
DFGLQTSTSPGRLPLSGKKFDYRAFAALPSSRPVYDIQSPDFVEELRTLDPSPSPGPQEE
DGEVALVLLGRPSPGTVGPEDMTLCSSRRAMRPGRRGLGPVPS
Download sequence
Identical sequences D3ZWS0
10116.ENSRNOP00000044022 ENSRNOP00000049099 NP_001178808.1.100692 NP_001178808.1.4139 ENSRNOP00000044022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]