SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000049153 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000049153
Domain Number 1 Region: 20-117
Classification Level Classification E-value
Superfamily DEATH domain 9.89e-21
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 
Domain Number 2 Region: 1012-1152
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000489
Family Nucleotide and nucleoside kinases 0.0042
Further Details:      
 
Domain Number 3 Region: 686-767
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000386
Family PDZ domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000049153
Domain Number - Region: 178-439
Classification Level Classification E-value
Superfamily Tropomyosin 0.00235
Family Tropomyosin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000049153   Gene: ENSRNOG00000024277   Transcript: ENSRNOT00000051382
Sequence length 1157
Comment pep:known chromosome:RGSC3.4:12:14187395:14229266:1 gene:ENSRNOG00000024277 transcript:ENSRNOT00000051382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTGGGPAMDDYMETLKDEEEALWDNVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEV
LNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVV
EEGHEGLTHFLMNEVIKLQQQVKAKDLQRCELLAKSRQLEDEKKQLNLIRVELLTFQERY
YKMKEERDSHNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKME
EECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKIQELQSIIQAGKRSLPDSDKA
ILDILEHDRKEALEDRQELVNKIYNLQEEVRQAEELRDKYLEEKEDLELKCSTLGKDCEM
YKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIE
MVRREACIVNLESKLRRLSKDSGSLDQSLPRHLPATIISQSLGDTSPRTNGQEADDSSTS
EESPEDSKYFLPYHPPRRRMNLKGIQVPRGTEPEHMAVSEGVHELMGGTVKGHEEDFTDG
SPSSSRSLPVTSSFSKMQPHRSRSSIMSITAEPPGNDSIVRRCKEDAPHRSTVEEDNDSC
GFDVLDLDDENHERYSFGPPSIHSSSSSHQSEGLDAYDLEQVNLMFRKFSLERPFRPSVT
SGGHVRGTSPLVQHTTLNGDGLITQLTLLGGNAHGSFIHSVKPGSLAEKAGLREGHQLLL
LEGCIRGERQSVPLDACTKEEARWTIQRCSGPVTLHYKVNHEGYRRLLKEMEDGLITSGD
SFYIRLNLNISSQLDACSMSLKCDDVVHVLDTIDTQRHTHIHTHTDTHTDTQTHTDTYTH
TYTTHIHTHRHTHTHRHTHTHTHTHTQRLTKNTLQPEEPLSASDPRVSPRLSRASFFFGQ
LLQFVSRSENKYKRMNSNERVRIISGSPLGSLSRSSLDATKLLTEKHEELDPENELSRNL
TLIPYSLVRAFHCERRRPVLFTPTMLAKTLVQKLLNSGGAMDILTPLSADIVTRDEYLRK
QKTETIIYSREKNPNTFECIVPANIEAVAAKNKHCLLEAGISCVRDLIKCKVYPIVLLIR
VSEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEAEMWSSVEELLRVLKD
KIVEEQRKTIWVDEDQL
Download sequence
Identical sequences 10116.ENSRNOP00000062277 ENSRNOP00000049153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]