SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000049188 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000049188
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily UBC-like 6.19e-34
Family UEV domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 309-460
Classification Level Classification E-value
Superfamily LDH C-terminal domain-like 1.12e-32
Family Lactate & malate dehydrogenases, C-terminal domain 0.0000887
Further Details:      
 
Domain Number 3 Region: 166-308
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.66e-30
Family LDH N-terminal domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000049188   Gene: ENSRNOG00000013624   Transcript: ENSRNOT00000045719
Sequence length 462
Comment pep:known chromosome:RGSC3.4:1:97490350:97518197:-1 gene:ENSRNOG00000013624 transcript:ENSRNOT00000045719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRWTGKYKFRDLTVEELKTVNMSFPHFRYSMDTYVFKDTSQKDLLNFTGTIPVMYQGKTY
NIPIRFWILDSHPFAPPICFLKPTANMEISVGKHVDAKGRIYLPYLQNWSHPKSVIVGLI
KEMIAKFQEELPLYSVPSSNEAQQVDLLAYITKITEGVSDINSRGWTNHENKIPNKITVV
GSGDLGIACTLAISAKGIADKLLLLDLSDGTNQGTMDLDIFNLPNVEISKDLSASAHSKV
VIFTANSLGGSESYLHAVQSNVDMFRALVPALGHYSQHAVLLVASQPVEIMSYVTWKLST
FPAARVMGIGCNLDSQRLQYIISSVLKAQTSGKEVWVVGEQGENKVCSWSGQDGVMSPSS
QAQLSSRAMGLLKVKGQRSWSVGLSVADLLDTIINNKKKVHSVSTLAKGYYGLDNEVFLS
LPCILGTSGVSEVLKTAAEDAVTEALQTSASSIHGLQQQLKL
Download sequence
Identical sequences 10116.ENSRNOP00000049188 ENSRNOP00000049188 ENSRNOP00000049188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]