SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000049377 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000049377
Domain Number 1 Region: 115-168
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000453
Family PDZ domain 0.00022
Further Details:      
 
Domain Number 2 Region: 4-43
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000863
Family PDZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000049377   Gene: ENSRNOG00000016292   Transcript: ENSRNOT00000044384
Sequence length 311
Comment pep:known chromosome:RGSC3.4:1:179489523:179502763:-1 gene:ENSRNOG00000016292 transcript:ENSRNOT00000044384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHTKLTVGSLGLGLVIIQNGPYLQISHLINKGAAASDGILQPAVFEQCVYGRHMALEGE
SMTARDAGQQCVGMEVTGGSWLLHAQTVQYRNEDTTDTEGTTDTEKLGLVAVLTLLEGDV
LISVGHANVLGYTLREFLKLLQNITIGTVLQIKAYRGFIEIPQEWKDVYDLIPETKFPIP
HTPKKTEQAKQSFESDEHEDTVLDHRLKYYRYPRSVWNHPVRIPLSISTEWHGYKKKDNT
ISVGKDVKSDVVIHKDDEKELRAPSPYWAMVEQDERISSSSSPASSISDAFWLEDFAQDK
EGKGEQVSKFG
Download sequence
Identical sequences Q6TUD9
ENSRNOP00000049377 ENSRNOP00000049377 10116.ENSRNOP00000049377 NP_001019948.2.100692 NP_001019948.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]