SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000050947 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000050947
Domain Number 1 Region: 31-460
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.88e-66
Family Cystathionine synthase-like 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000050947   Gene: ENSRNOG00000029993   Transcript: ENSRNOT00000043533
Sequence length 465
Comment pep:known chromosome:RGSC3.4:3:24046242:24195583:1 gene:ENSRNOG00000029993 transcript:ENSRNOT00000043533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMEPSPLELPVDAVRRIATELNCDPTDERVALRLDEEDKLKRFKDCFYIPKMRDLPSIDL
SLVNEDDNAIYFLGNSLGLQPKMVKTYLEEELDKWAKIGAYGHEVGKRPWIIGDESIVSL
MKDIVGAHEKEIALMNALTVNLHLLLLSFFKPTPKRHKILLEAKAFPSDHYAIESQIQLH
GLDVEKSMRMIKPREGEETLRMEDILEVIEKEGDSIAVVLFSGLHFYTGQLFNIPAITQA
GHAKGCFVGFDLAHAVGNVELHLHDWDVDFACWCSYKYLNSGAGGLAGAFIHEKHAHTIK
PALVGSFGCDICTRVNYENELQLIPGVNGFRISNPPILLVCSLHASLEIFQQATMTALRR
KSILLTGYLEYLLKHYHGGNDTENKRPVVNIITPSRAEERGCQLTLTFSISKKGVFKELE
KRGVVCDKREPEGIRVAPVPLYNSFHDVYKFIRLLTAILDSTERN
Download sequence
Identical sequences ENSRNOP00000050947 10116.ENSRNOP00000050947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]