SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000051145 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000051145
Domain Number 1 Region: 23-138
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.3e-20
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000051145   Gene: ENSRNOG00000032460   Transcript: ENSRNOT00000049962
Sequence length 267
Comment pep:known chromosome:RGSC3.4:7:71527067:71540042:-1 gene:ENSRNOG00000032460 transcript:ENSRNOT00000049962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRKIGVWKPVESKWISSSCEIIAFRKALLNPVIARQFQRFVALKGDLLENGVLFWQEVQK
FKDLCHSHCEESIIHKKITTIINCFINSCIPPALQIDIPVEQAQKIIEHRKELGPYVFRE
AQMTIFGVLFKFWPQFCEFRKNLTDEKIMSVLERRQEYKQKRKTSDIEEDKAAKSGVKQY
ASTTGSLTKPTLGSESLLVLQSYGRQPTWCYSKYIEALEQERILLKIQEEVERKMFTGTS
SFTNLLKPSTGSALSLKKNVSPHSIQS
Download sequence
Identical sequences ENSRNOP00000051145 10116.ENSRNOP00000051145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]