SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000051500 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000051500
Domain Number 1 Region: 468-532
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.22e-18
Family LIM domain 0.02
Further Details:      
 
Domain Number 2 Region: 409-471
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.48e-16
Family LIM domain 0.0018
Further Details:      
 
Domain Number 3 Region: 2-52
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000213
Family PDZ domain 0.00041
Further Details:      
 
Domain Number 4 Region: 376-407
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000025
Family LIM domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000051500
Domain Number - Region: 527-555
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00148
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000051500   Gene: ENSRNOG00000016419   Transcript: ENSRNOT00000050858
Sequence length 559
Comment pep:known chromosome:RGSC3.4:2:240177303:240296914:-1 gene:ENSRNOG00000016419 transcript:ENSRNOT00000050858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEP
VAVQKGEPKEVVKPVPITSPAVSKVTSTTNMAYNKVPRPFGSVSSPKVTSIPSPSSAFTP
AHAATSSHASPPPVAAVTPPPLSASGLHASANPSAAQCSSPPNTGKPAVHVPRQPTVTSV
CSESAQELAEGQRRGSQGDIKQQNGPPRKHIVERNTEFYHIPTHSDASKKRLIEDTEDWR
PRTGTTQSRSFRILAQITGTEHLKESENDNAKKANSRQEPSQMNANQSASPLSAAESLES
PGSNRPVVAGLRSAAAFKPVGSTSVKSPSWQRPNQAAPSTGRISNSASSSGTGAPVGPPQ
PSDQDTLVQRAEHIPAGKRTPMCAHCNQAIRGPFLVALGKSWHPEEFNCAHCKNTMAYIG
FVEEKGALYCELCYEKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVF
HLEDGEPYCETDYYALFGTICRGCEFPIEAGDMFLEALGSTWHDTCFVCSVCCESLEGQT
FFSKKDKPLCKKHAHSVNF
Download sequence
Identical sequences 10116.ENSRNOP00000051500 ENSRNOP00000051500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]