SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000051659 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000051659
Domain Number - Region: 20-77
Classification Level Classification E-value
Superfamily Aquaporin-like 0.0719
Family Aquaporin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000051659   Gene: ENSRNOG00000013043   Transcript: ENSRNOT00000017423
Sequence length 108
Comment pep:known chromosome:RGSC3.4:1:225663299:225663920:-1 gene:ENSRNOG00000013043 transcript:ENSRNOT00000017423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSSNNSTGRLAGFFRASMRSRQGALWPNTLGSLALLYSAFGVTIEKTRGSEDDLNPVAAG
TMTGMLYKCTGGLGGTSCGGLAGLTLTSLYALSNKWEHLKGSLLQQSL
Download sequence
Identical sequences 10116.ENSRNOP00000051659 ENSRNOP00000051659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]