SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000051870 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000051870
Domain Number 1 Region: 231-335
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000765
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000051870   Gene: ENSRNOG00000030537   Transcript: ENSRNOT00000054987
Sequence length 365
Comment pep:known chromosome:RGSC3.4:10:108730990:108741279:1 gene:ENSRNOG00000030537 transcript:ENSRNOT00000054987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARNALVVSFAALIAYAFEVTGSHPFILTGKIAQGLPPVRMPPFSVTTDNKTISFSEMVQT
RGEGCINQVPLSAPLSLSLSLSFTSQNNYRIDANQELLAIGLTNVLGSLVSSYPVTGSFG
RTAVNAQTGVCTPAGGLVTGVLVLLSLDYLTLLFYYIPKSALAAVIIMAVAPLFDVKIFR
RLWLVQRLDLLPLCVTFLLSFWEIQYGILAGTLVSLLILLHSVARPKTQVSEGQILVLQP
ASGLHFPAVDALREAMTKRALEASPPRSAVLECTHVSNIDYTVILGLGELLEDFQKKGVT
LAFVGLQVPVLRTLLAADLKGFQYFTTLEEAEKSLQQEPGTQPYSIREDTAPEHRSSLLK
SPSGP
Download sequence
Identical sequences 10116.ENSRNOP00000051870 ENSRNOP00000051870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]