SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052036 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052036
Domain Number 1 Region: 29-86
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052036   Gene: ENSRNOG00000036779   Transcript: ENSRNOT00000055162
Sequence length 88
Comment pep:known chromosome:RGSC3.4:3:155589364:155591507:-1 gene:ENSRNOG00000036779 transcript:ENSRNOT00000055162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLQASFSFFLILTFCQELCSEPRQVARKSLPSMCTLPMEKGECRAIFVRWYYDTKTKKC
DWFHYGGCRGNENNFLSRNQCQTVCAST
Download sequence
Identical sequences A0A0G2K680
10116.ENSRNOP00000052036 ENSRNOP00000052036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]