SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052264 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052264
Domain Number 1 Region: 695-884
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.95e-56
Family Nucleotide and nucleoside kinases 0.0000000952
Further Details:      
 
Domain Number 2 Region: 445-542
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-32
Family PDZ domain 0.000077
Further Details:      
 
Domain Number 3 Region: 546-660,689-723
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-31
Family SH3-domain 0.0000716
Further Details:      
 
Domain Number 4 Region: 117-220
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-30
Family PDZ domain 0.000041
Further Details:      
 
Domain Number 5 Region: 224-318
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-27
Family PDZ domain 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052264   Gene: ENSRNOG00000022635   Transcript: ENSRNOT00000055397
Sequence length 887
Comment pep:known chromosome:RGSC3.4:1:148486811:149274633:1 gene:ENSRNOG00000022635 transcript:ENSRNOT00000055397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAYLTKQHSCSRGSDGMDAGRSAPTLIRDAHCACGWQRNAQGLGYSSQTMPSSGPGGPA
SNRTKLVTLWDSVRKSPHKTSTKGKGNCGERCACPHGWFSPAQASPAPIIVNTDTLDTIP
YVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLR
VNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGF
SIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAIL
KNTSDVVYLKVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPG
RYSPIPKHMLVEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPYPHYHLG
LLPDSDMTSHSQHSTATRQPSVTLQRAISLEGEPRKVVLHKGSTGLGFNIVGGEDGEGIF
VSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPEDY
ARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYG
DILHVINASDDEWWQARRVILDGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSK
GDIPGLGDDGYGTKTLRGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPD
KFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVR
FVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLEPLMEMNKRLTEEQAKKTYDRA
IKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL
Download sequence
Identical sequences 10116.ENSRNOP00000052264 ENSRNOP00000052264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]