SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053098 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053098
Domain Number 1 Region: 387-1066,1096-1254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-192
Family Motor proteins 0.0000000235
Further Details:      
 
Domain Number 2 Region: 211-311
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000407
Family PDZ domain 0.0061
Further Details:      
 
Domain Number 3 Region: 1456-1572
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000209
Family Myosin rod fragments 0.0083
Further Details:      
 
Domain Number 4 Region: 1714-1823
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000863
Family Myosin rod fragments 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000053098
Domain Number - Region: 1255-1353
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00173
Family Myosin rod fragments 0.0081
Further Details:      
 
Domain Number - Region: 1543-1655
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0209
Family Myosin rod fragments 0.0024
Further Details:      
 
Domain Number - Region: 1772-1979
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053098   Gene: ENSRNOG00000033101   Transcript: ENSRNOT00000056256
Sequence length 2064
Comment pep:known chromosome:RGSC3.4:10:63842593:63860082:1 gene:ENSRNOG00000033101 transcript:ENSRNOT00000056256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNLMKKDKDKDGGRKEKKEKKEKKERMSAAELRSLEEMSMRRGFFNLNRSSKRESKTRL
EISNPIPIKVASGSDLHLTDIDSDSNRGSIILDSGHLSTASSSDDLKGEEGSFRGSVLQR
AAKFGSLAKQNSQMIVKRFSFSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLMQHS
GLGIPRPGPRSRVPELVTKRFPADLRLPALVPPPPPALRELELQRRPTGDFGFSLRRTTM
LDRAPEGQAYRRVVHFAEPGAGTKDLALGLVPGDRLVEINGQNVENKSRDEIVEMIRQSG
DSVRLKVQPIPELSELSRSWLRTGEGHRREPTDLDPVAASPAHSQAKTEEQIAAEEAWYE
TEKVWLVHRDGFSLASQLKSEELSLPEGKVRVKLDHDGAILDVDEDDVEKANAPSCDRLE
DLASLVYLNESSVLHTLRQRYGASLLHTYAGPSLLVLSPRGAPAVYSEKVMHMFKGCRRE
DMAPHIYAVAQTAYRAMLMSRQDQSIVLLGSSGSGKTTSSQHLVQYLATIAGTSGNKVFS
VEKWQALATLLEAFGNSPTIMNGSATRFSQILSLDFDQAGQVASASVQTMLLEKLRVARR
PASEATFNVFYYLLACGDSTLRTELHLNHLAENNVFGIVPLSKPEEKQRAAQQFSKLQTA
MKVLAISPEEQKACWLILASIYHLGAAGATKEAAEGGRKQFARHEWAQKAAYLLGCSLEE
LSSAIFKHQLKGGTLQRSTSFRQGPEESGLGEGTKLSALECLEGMASGLYSELFTLLISL
VNRALKSSQHSLCSMMIVDTPGFQNPEWGGSARGASFEELCHNYAQDRLQKLFHERTFLQ
ELERYKEDNIELAFDDLEPVTDDSVAAVDQASHQSLVRSLAHADEARGLLWLLEEEALVP
GATEDTLLDRLFSYYGPQEGDKKGQSPLLRSSKPRHFLLGHSHGTNWVEYNVTGWLNYTK
QNPATQNAPRLLQDSQKIGVGDLALRKGGNAQRLSGSIAGLEGGSQLALRRATSMRKTFT
TGMAAVKKKSLCIQIKLQVDALIDTIKRSKMHFVHCFLPVAEGWPGEPRSASSRRVSSSS
ELDLPPGDPCEAGLLQLDVSLLRAQLRGSRLLDAIRMYRQGYPDHMVFSEFRRRFDVLAP
HLTKKHGRNYIMVDEKRAVEELLESLDLEKSSCCMGLSRVFFRAGTLARLEEQRDEETSR
HLTLFQAACRGYLARQHFKKRKIQDLAIRCVQKNIKKNKGVKDWPWWKLFTTVRPLIQVQ
LSEEQIRNKDEEIQQLRNKLEKVEKERNELRLNSDRLETRISELTSELTDERNTGESASQ
LLDAETAERLRTEKEMKELQTQYDALKKQMEAMDMEVMEARLIRAAEINGEVDDDDAGGE
WRLKYERAVREVDFTKKRLQQELEDKMEVEQQNRRQLERRLGDLQADSDESQRALQQLKK
KCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDSELSQAHEETQREKLQREKLQREKDM
LLAEAFSLKQQMEEKDLDIAGFTQKVVSLEAELQDISSQESKDEASLAKVKKQLRDLEAK
VKDQEEELDEQAGSIQMLEQAKLRLEMEMERMRQTHSKEMESRDEEVEEARQSCQKKLRQ
MEVQLEEEYEDKQKALREKRELESKLSTLSDQVNQRDFESEKRLRKDLKRTKALLADAQI
MLDHLKNNAPSKREIAQLKNQLEESEFTCAAAVKARKAMEVEMEDLHLQIDDIAKAKTAL
EEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDMAQMNDLQAQLEESNKEK
QELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIRELETRLEFEKTQVKRLESMASRLKE
NMEKLTEERDQRAAAENREKEQNKRLQRQLRDTKEEMSELARKEAEASRKKHELEMDLES
LEAANQSLQADLKLAFKRIGDLQAAIEDEMESDENEDLINSLQDMVTKYQKRKNKLEGDS
DVDSELEDRVDGVKSWLSKNKGPSKAPSDDGSLKSSSPTSHWKSLAPDLSDDEHDPVDSI
SRPRFSHNYLSDSDTEAKLTETNA
Download sequence
Identical sequences 10116.ENSRNOP00000060487 ENSRNOP00000053098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]