SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053273 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053273
Domain Number 1 Region: 269-332,980-1084
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-30
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 2 Region: 888-978
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 1108-1208
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-19
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053273   Gene: ENSRNOG00000011042   Transcript: ENSRNOT00000056434
Sequence length 1229
Comment pep:known chromosome:RGSC3.4:9:97387509:97495982:-1 gene:ENSRNOG00000011042 transcript:ENSRNOT00000056434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGTSQPSGPACPKNVKDFEEDIKGHTSEAVFHQTRALGKLKESGDDYISASINGKQNSSF
LIKDEKKSSDNNIPKRMENGYPPPVVSHQLEEVLSVAMFNDREKSLPGKITTQDFSSTVE
VLKPAKGKFIREVKCGTFNVQVETTENVFYKTGAQFLTKRRRPTCHQHCSIQQVWRASKS
RRRFSKYRSVWAEDRVPSTQVREMSRSEVPSMNISIVGKEIVVKYVSKEQNISINVSHPK
SIGKSAKRSRGSLNHTTNEPCESPSQPGINLVEKQRPGNQNQNSESLPDAPCSVNTDQKK
NSDTVVASLSSPPRRETKKPSTPPSAPSDSEERDSDTSQQKVLQITQDKPLGQHCLTADT
CLPPSSETLRTTSLSNGDLSKMSFEGSRDVDEERKSSSDVRENITSESQVPLCTAGTNGP
LSAMGGMLPVQDASESEFCPLSCLTLLLLGEKAESIGCRGDRTLPGEGYESSNSISSVSE
EATKASPLLSPSHWGTRCSKPGETPGSTFSCSQYIEFETEQEKVHYRDINKAILHGNSSA
NTQPLERKTPRSPAVRTASCSSLVSKSSRRGDIRSSVEWDQTEGHAHHVGRAGLSRTEVP
ASAFLTDELEQRLTTQNYKEGAVDSNSPVAIRNPGELTSYLENVEDDTCHATAVVENACH
QDFEDLTSENQNEIGSQMKFAQNTTESACVGHTTEKLFLLDKTLTSDEDPTRNGDRDICG
LSNFRQELAECQRTVSTVHPEESGNERTFTEASYHPVDIPLSPQKQKALKDQNLEINNPR
KLSQELALRGGRASDGSQEEAIDQWARRRQQFKDGKRCSSAGGSSVISNFTEGSVTSDDA
PSVDFGFRGVDIEEKGFYTENFHSMAWVFRGDDGNPEDSPRCLSKKPRPVAVRERTVRLF
KGTGDYPWGFRIQFSKPIVVTEVDTNSAAEEAGLQIGDVVLSVNGTEVTSVEHAEAVHLA
KKGPDILTMVVGSDISRCPNTPWPTCRGYLHKRTHSGFVKGWRKRWFVLKHDGFLLYYKH
RKDEGKWPPVDVIKLEGAEVDIDNSLGKPFVFNCMPQSGSRTFCLCATSNQEMKRWLEAM
QKAARPVRQNHVWEDVTAHNSSLPPLAIKHPECLGLLHQLERSTDVWIQHYCILKDGCLY
FYASIRSTQASGGLYLQGYSVIEQTHGFEQPVIELRPSSEEFKTFYFCAENKTENQRWIA
ALKTSIKKWLPLDQAIQEFMNRPLEETRM
Download sequence
Identical sequences ENSRNOP00000053273 ENSRNOP00000014922 10116.ENSRNOP00000014922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]