SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000054167 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000054167
Domain Number 1 Region: 73-137
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00000000994
Family beta-sandwich domain of Sec23/24 0.015
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000054167
Domain Number - Region: 260-303
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0863
Family Duffy binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000054167   Gene: ENSRNOG00000037783   Transcript: ENSRNOT00000057354
Sequence length 315
Comment pep:known chromosome:RGSC3.4:16:85100866:85101810:1 gene:ENSRNOG00000037783 transcript:ENSRNOT00000057354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRGAWMCRQYDDGLKIWLAAPRENEKPFIDSERAQKWRLSLASLLFFTVLLSDHLWFCA
EAKLTRTRDKEHHQQQQQQQQQQQQQQQQQQQQQQRQQQRQRQQQRQRQQEPSWPALLAS
MGESSPAAQAHRLLSASSSPTLPPSPGGGGGSKGNRGKNNRSRALFLGNSAKPVWRLETC
YPQGASSGQCFTVESADAVCARNWSRGAAAGEEQSSRGSRPTPLWNLSDFYLSFCNSYTL
WELFSGLSSPSTLNCSLDVVLTEGGEMTTCRQCIEAYQDYDHHAQEKYEEFESVLHKYLQ
SDEYSVKSCPEDCKV
Download sequence
Identical sequences 10116.ENSRNOP00000054167 ENSRNOP00000054167 ENSRNOP00000054167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]