SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000054230 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000054230
Domain Number 1 Region: 189-642
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 3.01e-176
Family Class I alpha-1;2-mannosidase, catalytic domain 0.0000000000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000054230   Gene: ENSRNOG00000000800   Transcript: ENSRNOT00000057421
Sequence length 655
Comment pep:known chromosome:RGSC3.4:20:32694550:32766761:-1 gene:ENSRNOG00000000800 transcript:ENSRNOT00000057421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVGGLLPLFSSPGGGGLGGGLGGGLGGGRKGSGPAAFRLTEKFVLLLVFSAFITLCFGA
IFFLPDSSKLLSGVLFHSNPALQPPAEHKPGLGARAEDAAEGRVRHREEGVPGDPGAGLE
DNLARIRENHERALREAKETLQKLPEEIQRDILLEKEKVAQDQLRDKDLFGGLPKVDFLP
PIGVENREPADATIREKRSKIKEMMAHAWNNYKRYAWGLNELKPISKEGHSSSLFGNIKG
ATIVDALDTLFIMGMKTEFQEAKSWIKKYLDFNVNAEVSVFEVNIRFVGGLLSAYYLSGE
EIFRKKAVELGVKLLPAFHSPSGIPWALLNMKSGIGRNWPWASGGSSILAEFGTLHLEFM
HLAHLSGNPVFAEKVMNIRTVLNKLDKPEGLYPNYLNPSSGQWGQHHVSVGGLGDSFYEY
LLKAWLMSDKTDLEAKKMYFDAVQAIETHLIRKSSGGLTYIAEWKGGLLEHKMGHLTCFA
GGMFALGADGAPEARAQHYLELGAEIARTCHESYNRTYVKLGPEAFRFDGGVEAIATRQN
EKYYILRPEVIETYMYMWRLTHDPKYRTWAWEAVEALESHCRVNGGYSGLRDVYIAHESY
DDVQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNTEAHPFPILRDQKKEVDVQEK
Download sequence
Identical sequences G3V9N9
ENSRNOP00000054231 NP_001028828.1.100692 NP_001028828.1.4139 10116.ENSRNOP00000054231 ENSRNOP00000054230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]