SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000054286 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000054286
Domain Number 1 Region: 276-373
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-24
Family PDZ domain 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000054286
Domain Number - Region: 85-189
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0199
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000054286   Gene: ENSRNOG00000000408   Transcript: ENSRNOT00000057476
Sequence length 462
Comment pep:known chromosome:RGSC3.4:20:31055280:31105538:-1 gene:ENSRNOG00000000408 transcript:ENSRNOT00000057476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGPCPAGAGSGPGGASCPVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLGEIDPDQA
DITYEGRQKMTSLSSCVWRQLHKAQTVSQINHKLEAQLVDLRSELTETQAEKVVLEKEVH
DQLLQLHSTQLQLHAKTGQSVDSGAIKAKLSVHSMEDLERELEANKTEKVKEARLEAEVK
LLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQL
EAEIHLHRHKTVIRACRGRQDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLG
ISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAVLAVNGVNLRDTKHKEAVTILSQQR
GEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNSGASCKDSSGEMKVLQG
YNKKTVRDAHENGDVGASGESPLDDTAVRAAHPHSLHQKKAY
Download sequence
Identical sequences 10116.ENSRNOP00000054286 ENSRNOP00000054286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]