SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000054350 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000054350
Domain Number 1 Region: 142-379
Classification Level Classification E-value
Superfamily vWA-like 3.33e-61
Family Integrin A (or I) domain 0.000000138
Further Details:      
 
Domain Number 2 Region: 377-467
Classification Level Classification E-value
Superfamily Integrin domains 4.87e-30
Family Integrin domains 0.0000937
Further Details:      
 
Domain Number 3 Region: 633-716
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-18
Family Integrin beta tail domain 0.00033
Further Details:      
 
Domain Number 4 Region: 26-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000497
Family Plexin repeat 0.00067
Further Details:      
 
Domain Number 5 Region: 592-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Integrin beta EGF-like domains 0.0024
Further Details:      
 
Domain Number 6 Region: 549-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000165
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000054350
Domain Number - Region: 518-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 474-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family Integrin beta EGF-like domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000054350   Gene: ENSRNOG00000001795   Transcript: ENSRNOT00000049974
Sequence length 814
Comment pep:known chromosome:RGSC3.4:11:68642156:68758943:-1 gene:ENSRNOG00000001795 transcript:ENSRNOT00000049974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVPATLYACLLGLCALVPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEYFGNPRSI
ISRCDLKANLIRNGCGGEIESPASSTHVLRNLPLSSKGSSAMGSDVIQMTPQEIAVSLRP
GEFLRVGRVPQSQISPVVYFCLCDFAYSGQDLLQSLHILGSRVSEELPNFNEPFRLAVGS
NFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASDQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
HGDSKNIIQLIINAYSSIRAKVELSVWDQPEDLNLFFTATCQDGLSYPGQRKCEGLKIGD
TASFEVSVEARSCPGRHTTQSFTLRPVGFRDSLQVEVAYNCTCGCSAGLEPNSARCSGNG
TYVCGLCECDPSYLGTRCECQEGENQSGYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GRIYGPFCECDSFSCARNKGVLCSGHGECHCGECKCHVGYIGDNCNCSTDISTCRAKDGQ
ICSDRGRCVCGQCQCTEPGAFGETCEKCPTCPDACSSKRDCVECSLLHQGKPDNQTCHHQ
CKDEVITWVDSIVKDDQEAVLCFYKTAKDCVMMFSYTELPNGKSNLTVLREPECGSAPNA
MTILLAVVGSILLVGMALLAIWKLLVTIHDRREFAKFQSLKPPVQKAHLHTYCRFCLQQV
QQILQWLSGLLLDGWRGTEDKDGVSRTPWTICSR
Download sequence
Identical sequences 10116.ENSRNOP00000002446 ENSRNOP00000054350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]