SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000054782 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000054782
Domain Number 1 Region: 208-677
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.06e-189
Family GABA-aminotransferase-like 0.0000000000000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000054782   Gene: ENSRNOG00000005275   Transcript: ENSRNOT00000057973
Sequence length 681
Comment pep:known chromosome:RGSC3.4:10:46936605:46945445:-1 gene:ENSRNOG00000005275 transcript:ENSRNOT00000057973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELTVEAWVQIFLLPVEKSDPVSRLDPDRMGHVKGPVQMIQNCRISTTQGNNRITQRSPG
YTPDSPTKSFSLWNSQNLLVQSMKLAASAVSIWFWGSWRIPRELLVFSLHWNLKEVGLST
SPSNSTNLPARVKGKQAEKQSFLLLSSFIWVAIRSYSSFCQVLPKFLLRARANGAWAAEG
GLYLDPPTDWAALGVGRGQPRCAMAERDATVWASHEKMLTQPLKESDAEVYSIIKKESNR
QRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQA
YHLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISAT
SIFFESMPYKVYPDTGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDNGA
YLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVRSVDPKTGEE
TYYELESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTTEFKIYQLQVLANCRALSDALT
ELGYKIVTGGSDNHLILMDLRPKGTDGGRAEKVLEACSIACNKNTCPGDKSALRPSGLRL
GTPALTSRGLLEEDFQKIAHFIHRGIELTLQIQSHMTMRATLKEFKEKLTGDEKFQSAVA
ALREEVENFASNFSLPGLPDF
Download sequence
Identical sequences Q6TXG7
10116.ENSRNOP00000007092 ENSRNOP00000007092 NP_001041307.1.100692 NP_001041307.1.4139 ENSRNOP00000054782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]