SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000054853 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000054853
Domain Number 1 Region: 1801-2083
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.77e-77
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0004
Further Details:      
 
Domain Number 2 Region: 677-843
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.41e-39
Family Group II chaperonin (CCT, TRIC), apical domain 0.00055
Further Details:      
 
Domain Number 3 Region: 354-484
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.06e-29
Family DEP domain 0.0038
Further Details:      
 
Domain Number 4 Region: 154-226
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0036
Further Details:      
 
Domain Number 5 Region: 630-683,836-856
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.0000101
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000054853
Domain Number - Region: 1407-1509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.015
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000054853   Gene: ENSRNOG00000015158   Transcript: ENSRNOT00000058045
Sequence length 2097
Comment pep:known chromosome:RGSC3.4:9:63798657:63890646:1 gene:ENSRNOG00000015158 transcript:ENSRNOT00000058045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDDKSSPTLDSANDLPHSPASPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERG
EGGQGEQQSPSSSWSSPQIPSRTQSVRSPVPYKKQLNEELHRRSSVLDSRRKAEPACGGH
DPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHC
RLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDST
CSVSILDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSSSALSTRLVSVQEDAGKSP
ARNRSASITNLSLDRSGSPMVPSYETSVSPQANRNYIRTETTEDERKILLDSAQLKDLWK
KICHHTSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLD
CVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQI
AEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPH
PADQKEYLVSDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENE
EKQAMERLLSANHNHMMALLQQLLQNESLSSSWRDIIVSLVCQVVQTVRPDVKHQDDDMD
IRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMNSCIKNPKILLLKCSIEYLYREETK
FTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQVL
ERISRMTQGDLVVSMDQLLTKPHLGTCHKFYMQLFQLPNEQTKTLMFFEGCAQHLGCTIK
LRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLTQSPSFHFLAEGRGEEG
ASQEQVSGSSLPQDPECPFDALSSDDSTLLESRTVPEKGELDNKSVPQAVASLKHQDYTT
PTCPAGIPCALFALVPESLLPLHMDQQDAVGDEQPETSQQTVEQQDPKSQMRAFRDPLQD
DTGMYVTEEVTSSEDKRKTYSLTFKQELKDVILCISPVITFREPFLLTEKGMRCSTRDYF
PEQIYWSPLLNKEVKEMESRRKKQLLRDLSGLQSMNGNVQTKSIQVLPSHELVSTRIAEH
LGDSQSLGRMLADYRARGGRIQSKHLDPFVHSKDTSCTSGSKSGNKTESDEERGLIPSDV
LWPTKVDCLNPANHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLERY
CFRSSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICKQ
VTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVASFS
YSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYLAVDERLASLKTDTFSK
TREEKMEDIFAQKEMEEGEFKSWTEKMQARLMSSCVDTPQQLQSVLESLIAKKQSLCEAL
QAWNSRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISAMDTSPRNISPGLHNGEKEDRF
LTTLSSQSSTSSTHLQLPTPPEALAEQLVGGPSDLDTASGSEDVFDGHLLGSTDSQVKEK
STMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKEYR
NALEELSKATLWNNAEEGLPTNSALDNRPKSSSPIRLPEVSGGQTNRTVEGEPQPTKKAS
GMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQTGKEGMESQGLEPQDEVDGGDTQK
KQLTNPHVELQFSDANAKFYCRLYYAGEFHKMREVILGSSEEDFIRSLSHSSPWQARGGK
SGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIGY
KNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLLK
MVRDNPLYIRSHSKSVLRTSIHSDAHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRTF
TWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLDLNC
Download sequence
Identical sequences ENSRNOP00000020447 ENSRNOP00000054853 10116.ENSRNOP00000020447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]