SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000054925 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000054925
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily UBC-like 0.00000549
Family RWD domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000054925   Gene: ENSRNOG00000038178   Transcript: ENSRNOT00000058119
Sequence length 177
Comment pep:known chromosome:RGSC3.4:X:81802208:81802775:-1 gene:ENSRNOG00000038178 transcript:ENSRNOT00000058119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGANEDQETELEALCFRELSPVSFQYRIGEDSDPKAFLIEISWTETPQTPPVISMNAFFN
NTISLAVKQSILAKLQEAREVDLGTMTYTLFEYAKDNKEEFMENHHPGSSTTPIANIISV
ETPSTGPSSKKKRKEQLSKVQKCKPADQTDHKGELSRGWNWVDVVKHLSKSGSKDDE
Download sequence
Identical sequences ENSRNOP00000054925 10116.ENSRNOP00000054925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]