SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000054984 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000054984
Domain Number 1 Region: 264-391
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-41
Family Regulator of G-protein signaling, RGS 0.0000265
Further Details:      
 
Domain Number 2 Region: 2-73
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-19
Family DEP domain 0.02
Further Details:      
 
Domain Number 3 Region: 192-253
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 2.49e-18
Family Transducin (heterotrimeric G protein), gamma chain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000054984   Gene: ENSRNOG00000008082   Transcript: ENSRNOT00000058181
Sequence length 396
Comment pep:known chromosome:RGSC3.4:6:106873826:106964512:1 gene:ENSRNOG00000008082 transcript:ENSRNOT00000058181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIAGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYVFPISDHVLTMKDDGTFYRFQAPYF
WPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQV
KIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSKGGVTE
VSQCLSELHYLYIAKTQREDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPFI
TPAEPSNPWISDDITLWDIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSS
ENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRY
TFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKK
Download sequence
Identical sequences 10116.ENSRNOP00000054984 ENSRNOP00000054984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]