SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000055670 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000055670
Domain Number 1 Region: 735-924
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.54e-60
Family Nucleotide and nucleoside kinases 0.0000000619
Further Details:      
 
Domain Number 2 Region: 556-670,729-763
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-31
Family SH3-domain 0.0000555
Further Details:      
 
Domain Number 3 Region: 456-553
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-30
Family PDZ domain 0.0000242
Further Details:      
 
Domain Number 4 Region: 206-312
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-28
Family PDZ domain 0.0000219
Further Details:      
 
Domain Number 5 Region: 314-406
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-26
Family PDZ domain 0.000044
Further Details:      
 
Domain Number 6 Region: 4-63
Classification Level Classification E-value
Superfamily L27 domain 1.88e-21
Family L27 domain 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000055670   Gene: ENSRNOG00000038597   Transcript: ENSRNOT00000058883
Sequence length 927
Comment pep:known chromosome:RGSC3.4:11:70735284:70930012:-1 gene:ENSRNOG00000038597 transcript:ENSRNOT00000058883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTL
LDNPKCVDHSKQCEPVQPGNPWESGSLSSAAVTSESLPGGLSPPVEKYRYQDEEVLPSER
ISPQVPNEVLGPELVHVSEKSLSEIENVHGFVSHSHISPIKPTEAVPPSSPIVPVTPALP
VPAESPVVLPSTPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAG
SIVRLYVKRRKPASEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYINDGYAPPDIT
NSSSQSVDNHVSPSSYLGQTPASPARYSPISKAVLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSVSSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRGDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQE
EYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDG
RDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKR
LQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTL
EDIYNQVKQIIEEQSGPYIWVPAKEKL
Download sequence
Identical sequences 10116.ENSRNOP00000055673 ENSRNOP00000055670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]