SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000055793 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000055793
Domain Number 1 Region: 195-377
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.15e-31
Family Nucleotide and nucleoside kinases 0.0005
Further Details:      
 
Domain Number 2 Region: 9-69
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000197
Family PDZ domain 0.00064
Further Details:      
 
Domain Number 3 Region: 67-180
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000243
Family SH3-domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000055793   Gene: ENSRNOG00000038657   Transcript: ENSRNOT00000059013
Sequence length 381
Comment pep:known chromosome:RGSC3.4:9:51727655:51728859:1 gene:ENSRNOG00000038657 transcript:ENSRNOT00000059013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATVHNQLDFVFISWVVKEGPAEKSGLLNKGDGVLEINSIEIQGKDVNEVFDLLSDMYGTL
TFVLIPTQQIKPPPAKETIIHVKAHFDYDPSDDPYVPCQELGLSFQNGSYTSYDQAYKEE
DKDNPLAGHIPGKSFQQQRKAMKQTIEEDKESEKSGKIWYKKKEKVLYNANKNDDYDNEE
ILTYEEMSLYHQPANRKRAIILISPQNCGQNKLCRRLINKEKDHFAFAVLIELRIGETMI
DGRDYHFVSEQAFEADIAAGKFIEHGEFEKNLYGNSIDSIWQNMSFKSLNTVLEDPLKPY
IIFIAPPSPERLWSLLAKEGKNPKLEELRKIIEKTRETVQNNGLYLDTAIVNSDLDKAYR
EFLLINKLDTEPQWVPSTWLR
Download sequence
Identical sequences 10116.ENSRNOP00000055793 ENSRNOP00000055793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]