SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000055805 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000055805
Domain Number 1 Region: 6-150
Classification Level Classification E-value
Superfamily UBC-like 3.41e-55
Family UBC-related 0.000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000055805   Gene: ENSRNOG00000009038   Transcript: ENSRNOT00000059025
Sequence length 152
Comment pep:known chromosome:RGSC3.4:7:32719959:32750001:1 gene:ENSRNOG00000009038 transcript:ENSRNOT00000059025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKSNEAQAIETARAWTRLYAMNNI
Download sequence
Identical sequences Q9EQX9
NP_446380.1.100692 NP_446380.1.4139 XP_004269591.1.21590 XP_019808244.1.83887 ENSRNOP00000055805 10116.ENSRNOP00000055805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]