SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000055878 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000055878
Domain Number 1 Region: 22-436
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.03e-104
Family GABA-aminotransferase-like 0.00000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000055878   Gene: ENSRNOG00000022076   Transcript: ENSRNOT00000059104
Sequence length 481
Comment pep:known chromosome:RGSC3.4:10:37100238:37117741:1 gene:ENSRNOG00000022076 transcript:ENSRNOT00000059104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADRRAKAATLDLRRRLLSSSCRLFFPENPVKIIRGQGQYLYDEQGREYLDCINNVAHV
GHCHPTVVQAAHEQNLVLNTNSRYLHDNIVDYAQRLSETLPEKLSVFYFLNSGSEANDLA
LRLARQYTGHQDVVVLDHAYHGHLSSLIDISPYKFRNLDGQKEWVHVAPLPDTYRGPYRE
DHPDPAGAYASEVKHVISSAQKKGRKIAAFFAESLPSVSGQIIPPAGYFSQVAEHIRRAG
GLFVADEIQVGFGRVGKHFWAFQLEGEDFVPDIVTMGKSIGNGHPVACLATTQAVSRAFE
ATGVEYFNTFGGNPVSCAVGLAVLDVLKTEQLQAHATNVGSFLMEHLSQQKAKHPIIGDV
RGTGLFIGVDLIKDETLRTPATEEAEYLVSRLKENYILLSTDGPGRNILKFKPPMCFSLD
NAQHVVAKLDDILTDMEEKVRSCETLRIKHPPGSTGPGCRAAAGSRPSNLEQGNLVIKSA
P
Download sequence
Identical sequences XP_008765869.1.100692 ENSRNOP00000055878 10116.ENSRNOP00000055878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]