SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000055956 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000055956
Domain Number 1 Region: 831-961
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.11e-46
Family Regulator of G-protein signaling, RGS 0.00000618
Further Details:      
 
Domain Number 2 Region: 13-93
Classification Level Classification E-value
Superfamily PDZ domain-like 4.53e-18
Family PDZ domain 0.0000199
Further Details:      
 
Domain Number 3 Region: 271-374
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000422
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000055956   Gene: ENSRNOG00000024501   Transcript: ENSRNOT00000059183
Sequence length 967
Comment pep:known chromosome:RGSC3.4:5:79624388:79709034:1 gene:ENSRNOG00000024501 transcript:ENSRNOT00000059183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRFNGLCKVCSERRYRQITIRRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTV
LQLNERPVEHWKCVELAHEIRSCPSEIILLVWRVVPQIKPGPDGGVLRRASCKSTHDLLS
PPNKREKNCTHGAPTRPEQRHSCHLVCDSSDGLLLGGWERYTEVGKRSGQHTLPALSRAT
TPTDPNYIILAPLNPGSQLLRPVYQEDAIPEEPGTTTKGKSYTGLGKKSRLMKTVQTMKG
HSNYQDCSALRPHIPHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGR
NKTSQVTLFAYSDLLLFTKEEEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAE
CLFTLEAHSQEQKKRVCWCLSENIAKQQQLAATPTERKMFETEADEKEMPLVEGKGPGAE
ERTPSKDPSPSQELPPGQELPPSKDPSPSQELPPGQDLPPSKDPSPSQELPPGQELPPSK
DPSPSQELPAGQDLPPRKESFSGQEAAPGPESPSSEDIATCQNPPQSPETSTSKDSPPGQ
GSSPTTEVPSCQGLPAGQESTSQDPLLSQEPPAIPESSASDQNVLPSQESPPSQGSLSEK
ALAEQTISPGELPAATAGEPSASRPNFVIPEVRLDSAYSQQDGAHGGSSGEDEDAEEGEE
GEEGEEDEEDDTSDDNYGDRNEAKRSSLIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQE
ARGPCFASDTTLHCSDGEGTTSTWAIPSPRTLKKELGRNGGSMHHLSLFFTGHRKMSGTD
LADDVEASRKRKSKNIAKDMKNKLAIFRRRNESPGAQPAGKADKTTKSFKPTSEEALKWS
ESLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIA
IQACKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQ
KKMSPPL
Download sequence
Identical sequences G3V9Q2
10116.ENSRNOP00000055956 ENSRNOP00000055956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]