SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056031 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056031
Domain Number 1 Region: 59-91,227-301
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000137
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056031   Gene: ENSRNOG00000000512   Transcript: ENSRNOT00000059264
Sequence length 488
Comment pep:known chromosome:RGSC3.4:20:6886488:6898565:-1 gene:ENSRNOG00000000512 transcript:ENSRNOT00000059264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVWMVTFSAAIFLGLDVGLLISLVFTFFVITVRSHRTKILVLGQIPNTNIYRNVNEYREV
ILIPGVKILQCCSSITFVNVYHLKHKLLKEVNMVKLPLKEEEIYALFHESETSIAENKLC
RCFCDCEELEPESRVVYTERYENKQEHGSSINLIRCSYLGSGDSSQTTSEEQVPYTVSST
SQRNIGQNYEDTEKAWLPNSPPRNSSLPPPENSESLAQSRSRSVILPYSDTHTIILDFSM
VHYVDNRALVVLRQMCNAFHNADILVLISGCHTSVVKLFEKNDFFDDGITKAQLFLSLHD
AVLFALSRKCSEPSDLSVDETETVIQETYSESDKNDNLSNLRFKPGNVIMEGSQHASPNY
TKTHRPAKNDLEFDLDPDRLLASDQTSGMDLNLDLDLDLGRESDLDPGSELGSEIQAKPE
LESELEIDVQTEPETEEESERERKSQPRTRTRAQSPWQSYLTAYRFGSTSSQSAGPPQTP
QTRPAEKR
Download sequence
Identical sequences B2GUX9
ENSRNOP00000056031 10116.ENSRNOP00000056031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]