SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056187 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056187
Domain Number 1 Region: 18-116
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-17
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056187   Gene: ENSRNOG00000024322   Transcript: ENSRNOT00000059431
Sequence length 1491
Comment pep:known chromosome:RGSC3.4:X:42290709:42462067:-1 gene:ENSRNOG00000024322 transcript:ENSRNOT00000059431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAEPRARPERLAEAEARATDGVRLVEVQLSGGAPWGFTLKGGREHGEPLVITKIEEGS
KAASVDKLLAGDEIVAINDVTLSGFRQEAICLVKGSHKTLKLVVKRKSDPSWRPHSWHAT
KYFDVHPEPPVSLFLNSSSSPSWKSQHQASSSSHDLSGSWEHTSLQRTSDHFSSMGSIDS
LDHSSQLYPSGHLSSAKSNSSIDHLGGHSKRDSAYGSFSTCSSTPDHTLPKADASSTENI
LYKVGLWEASRPGSSRQSQSTGDPQGLQDRPSSFLPRVPGNSSKSPRPEDNIEPKIATSG
RSNFGPVWYVPDKKKAPSPPPLGLPLRSDSFAVAARGHEKARGPPFSDLASMQHFTTLPH
VQPRGDRRMETTDRQWKLAHPSSGKEIGNVGYQPEGHLDCRWLCSDDRAGRPSGAPGRHQ
FSLSSTDVHFLKSYHGSQHPQPCSDESPRFPSSPRELLRITPSGCLQEPPELSQDDNPAQ
VRWPGSVNQKLDDRGRSHYFSVPHRQPVHGSAHVLIPRSDYWHSDTTPVDLECPLLRPDQ
RGYPQQYEETPASHERGGYQQLNAGIEGCCSGIHEPPRASHTVRAGLQCPGNDFKLVDAE
SGRISRQRTPMLHSLTQDGAWRPGNSKDCGNEKPPLLDAQVGKPTRRSDRFATTLRNEIQ
MRRAKLQKSKSTVTLAGDSEAEDCAGDWRVDVGAVPEGSFPSTYKEHLKEAQTRVLKATS
FQRRDLDPTPADQYPGPPEHRTCDHSASSSLSSFPGEPDSAPRLCEAGLAKPPSSAGGVP
HILRIGGRKRFTAEQKLKSYSEPEKINEVGLSGDHSPHPTIRTSEDSVGTFADRWKFFEE
TSKSLLQKPGHRQAFCGIPREKAERPQTQGHECESTEPWFQKRSRATSCGEILSEDRKVE
KASEKLNPPRRLGTFAEYQASWKEQKKSLEARSSGRYHSADDILDAGLDQQQRPQYIHER
SRSSPSTDHYSQEVPVEPNRQAEDSGGQKEALLCTLQAEEGCSAPSSSVLSSAQPQDSQH
VNEDPTSPQPEAQLSSKCQHLQTSTMETSRSPSPQFAPQKLTDKPPLLIHEDNSARIERV
MDNNTTVKMVPIKIVHSESQPEKESRQSLACPAELPALPSGLEKDQIKTLSTSEQCYSRF
CVYTRQEVETPHRARPPEPQPPSTPAPPVRDSCSSPPSLNYGKAKEKTVDDLKSEELARE
IVGKDKSLADILDPSVKIKTTMDLMEGIFPKDEYLLEEAQQRRKLLPKVPSPRVTEDKKQ
DPGMPGVVSLATNSTYYSTSAPKAELLIKMKDLQEPEEYSAGDLDHDLSIKKQELIDSIS
RKLQVLREARESLLEDIQANNALGDEVEAIVKDVCKPNEFDKFRMFIGDLDKVVNLLLSL
SGRLARVENALNNLDDSPSPGDRQSLLEKQRVLTQQHEDAKELKENLDRRERIVFDILAT
YLSEENLADYEHFVKMKSALIIEQRELEDKIHLGEEQLKCLFDSLQPERSK
Download sequence
Identical sequences 10116.ENSRNOP00000056187 NP_001041358.2.100692 NP_001041358.2.4139 ENSRNOP00000056187 ENSRNOP00000056187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]