SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056799 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056799
Domain Number 1 Region: 621-932
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.7e-91
Family Protein kinases, catalytic subunit 0.000000053
Further Details:      
 
Domain Number 2 Region: 217-292
Classification Level Classification E-value
Superfamily HR1 repeat 1.31e-23
Family HR1 repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 127-197
Classification Level Classification E-value
Superfamily HR1 repeat 1.44e-23
Family HR1 repeat 0.0000219
Further Details:      
 
Domain Number 4 Region: 24-102
Classification Level Classification E-value
Superfamily HR1 repeat 1.44e-19
Family HR1 repeat 0.00000991
Further Details:      
 
Domain Number 5 Region: 329-352,396-486
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000016
Family PLC-like (P variant) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056799   Gene: ENSRNOG00000004131   Transcript: ENSRNOT00000060050
Sequence length 951
Comment pep:known chromosome:RGSC3.4:19:26137940:26160471:1 gene:ENSRNOG00000004131 transcript:ENSRNOT00000060050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADPPLDLELESEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLKREIRKELKLKEG
AENLRRATTDLGRSLAPVELLLRGSARRLDLLHQQLQELHAHVVLPDPTAGSDAPQSLAE
GSPVCSSTNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKT
KIDIIRMQLRRALQALQAGQLESQAAPDEAHGDPDLGAVELRIEELRHHFRVEHAVAEGA
KNVLRLLSAAKAPDRKAVSEAQEKLTESNQKLGLLRESLERRLGELPADHPKGRLLREEL
TAASSAAFSAILPGPFPATHYSTLSKPAPLTGTLEVRVVGCKNLPETIPWSPPPSVGASG
TPDSRTPFLSRPARGLYNRSGSLSGRSSLKGEAENSTEVSTVLKLDNTVVGQTAWKPCGP
NAWDQSFTLELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVA
EVTFRNPIIERIPRLQRQKKIFSKQQGQTFQRARQMNIDVATWVRLLRRLIPNAVATGSF
SPNASPGSEIRSTGDISMEKLNLGADSDSSSQKSPAGLPSTSCSLSSPTHESTTSPELPS
ETQETPGPGLCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFHSSGELFAIKALKKGDI
VARDEVESLMCEKRILATVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDV
FSEPRAVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDR
TSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDE
VRYPRFLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRTLDWDALLARRLPPPF
VPTLSGRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFRDFDFVAGGY
Download sequence
Identical sequences ENSRNOP00000056799 10116.ENSRNOP00000056799 XP_006255307.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]