SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056855 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056855
Domain Number 1 Region: 212-273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.33e-20
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 39-173
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.26e-16
Family Synaptotagmin-like (S variant) 0.073
Further Details:      
 
Domain Number 3 Region: 153-212
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000707
Family Complement control module/SCR domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056855   Gene: ENSRNOG00000042901   Transcript: ENSRNOT00000060107
Sequence length 274
Comment pep:known chromosome:RGSC3.4:13:53135401:53150381:-1 gene:ENSRNOG00000042901 transcript:ENSRNOT00000060107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFCRLLFLVNVLLTSWFSSAKGEGIHCDFPKIRHGIVYDEKKYEPFSPVPGGKILYYSC
EYNFASPSSSFWNPIICTEAGWSPVPKCLRICFFPSVENGHSTSSGQTHKEGDIVQIVCN
QGYSLQNNQSTITCGEEGWSIPPKCISPNSAGKCGPPPSIDNGDITSLSLPEYAPLSSVE
YQCQNYFLLKGNKIITCRNGKWSDPPTCLHACVIPEDILEKHNIVLRWRENGRIYSQSGE
NIEFMCKPGYRKLRGSPPFRSKCIDGHINYPTCL
Download sequence
Identical sequences Q5I0M3
10116.ENSRNOP00000017195 ENSRNOP00000017195 ENSRNOP00000056855 NP_001037692.1.100692 NP_001037692.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]