SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056903 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056903
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily UBC-like 1.88e-44
Family UBC-related 0.000000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056903   Gene: ENSRNOG00000009600   Transcript: ENSRNOT00000060159
Sequence length 173
Comment pep:known chromosome:RGSC3.4:4:57124757:57216518:-1 gene:ENSRNOG00000009600 transcript:ENSRNOT00000060159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGF
MNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMY
LHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
Download sequence
Identical sequences F6TMW7
10116.ENSRNOP00000056903 9544.ENSMMUP00000023089 9796.ENSECAP00000013123 ENSRNOP00000056903 XP_020015667.1.5219 ENSMMUP00000023089 ENSMMUP00000023089 ENSECAP00000013123 ENSECAP00000013123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]