SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056955 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056955
Domain Number 1 Region: 5-44
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000518
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056955   Gene: ENSRNOG00000039302   Transcript: ENSRNOT00000060208
Sequence length 44
Comment pep:known chromosome:RGSC3.4:X:29125307:29125438:1 gene:ENSRNOG00000039302 transcript:ENSRNOT00000060208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENRPGSFQYVPVQLQGGAPWGFTLKGGLEHCEPLTVSKVRSGG
Download sequence
Identical sequences ENSRNOP00000056955 10116.ENSRNOP00000056955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]