SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000057514 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000057514
Domain Number 1 Region: 48-170
Classification Level Classification E-value
Superfamily UBC-like 3.91e-33
Family UBC-related 0.00000393
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000057514   Gene: ENSRNOG00000039638   Transcript: ENSRNOT00000060786
Sequence length 171
Comment pep:known chromosome:RGSC3.4:9:17612735:17785239:-1 gene:ENSRNOG00000039638 transcript:ENSRNOT00000060786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSSSSSSSSSSSSSSLANKQASKQTNKRTEPETKAELNLGSNKMVGLPLGIVKETQRWL
AESIPDIKEKPDEKNAHYFHVVIAGPQDFPFKGRNFKLEPFLQEYPMAAPKVRFMTKIYH
PRVDKLGRKYLVILKDKWTPALQIRTVLLLIQALLSDPNPDDPLANDIAEQ
Download sequence
Identical sequences ENSRNOP00000057514 10116.ENSRNOP00000057513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]