SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000057748 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000057748
Domain Number 1 Region: 319-637
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-85
Family Protein kinases, catalytic subunit 0.00000151
Further Details:      
 
Domain Number 2 Region: 132-232
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 4.71e-43
Family MAST3 pre-PK domain-like 0.0000128
Further Details:      
 
Domain Number 3 Region: 890-982
Classification Level Classification E-value
Superfamily PDZ domain-like 7.62e-19
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000057748   Gene: ENSRNOG00000010720   Transcript: ENSRNOT00000061032
Sequence length 2370
Comment pep:known chromosome:RGSC3.4:2:33648515:33722016:-1 gene:ENSRNOG00000010720 transcript:ENSRNOT00000061032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLSTGNSPQDSPRNFSPSASAHFSFARRTDGRRWSLASLPSSGYGTNTPSSTVSSSCSS
QEKLHQLPYQPTPDELHFLSKHFCTTESIATENRCRNTPMRPRSRSLSPGRSPACCDHEI
IMMNHVYKERFPKATAQMEDRLKEIVTSYSPDNVLPLADGVLSFTHHQIIELARDCLDKS
HQGLITSRYFLELQHKLDKLLQEAHDRSESGELAFIKQLVRKILIVIARPARLLECLEFD
PEEFYYLLEAAEGHAKEGQGIKSDIPRYIISQLGLNKDPLEEMAQLGNYDSRTAETPETD
ESVSSSNTSLRLRRKPRESDFETIKLISNGAYGAVYFVRHKESRQRFAMKKINKQNLILR
NQIQQAFVERDILTFAENPFVVSMYCSFETRRHLCMVMEYVEGGDCATLMKNMGPLPVDM
ARMYFAETVLALEYLHNYGIVHRDLKPDNLLVTSMGHIKLTDFGLSKVGLMSMTTNLYEG
HIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPE
ELFGQVISDEINWPEKDEAPPPDAQDLITLLLRQNPLERLGTGGAYEVKQHRFFRSLDWN
SLLRQKAEFIPQLESEDDTSYFDTRSEKYHHMETEEEDDTNDEDFTVEIRQFSSCSHRFS
KVFSSIDRITQNSGEDKDDSEDKTKSTTLPSTETLSWSSEYSEMQQLSTSNSSDTESNRC
KLSSGLLPKLAISAEGEHGEAVPCSGDPREEPDKPVLPPEEGTQEEPEVTTPASTISSST
LSVGSFSEHLDQINGRSECVDSTDNSSKPSSESASHMARQRLESTEKKKMSGKVTKSLSA
SALSLMIPGDMFAVSPLGSPMSPHSLSSDPSSSRDSSPSRDSSAASASPHQPIVIHSSGK
NYGFTIRAIRVYVGDSDIYTVHHIVWNVEEGSPACQAGLKAGDLITHINGEPVHGLVHTE
VIELLLKSGNKVSITTTPFENTSIKTGPARRNSYKGRMVRRSKKSKKKESLERRRSLFKK
LAKQPSPLLHTSRSFSCLNRSLSSGESLPGSPTHSLSPRSPTPSYRSTPDFPSGTNSSQS
SSPSSSAPNSPAGSGHIRPSTLHGLAPKLSGQRYRSGRRKSAGSIPLSPLARTPSPTPQP
TSPQRSPSPLLGHSLGSAKITQAFPSKMHSPPTIVRHIVRPKSAEPPRSPLLKRVQSEEK
LSPSYGSDKKHLCSRKHSLEVTQEEVQREQCQREVMLQSLEENVYDAPSLSRARPVEQGC
LKRPVSRKMGRQESADDLDRDKLKAKVVVKKPEEKHEPHQKPHSLGSDSESYALFRLEER
EKKVYPKGLERSGHFENTSAESPSVGSLLKDTLHKQASVRASEGVTLDGAACSLAPGEHS
QSLGDFKRASASGNLHDSVCPISDRPAPGKVEYSEKASQAKELLRSEKLDSKLANIDYLR
KKMSLDDKDDSHCAILKPKITSSTHECLLGNPVRPMAGQQETLSASENRAFINSTHTPQM
SGVSFVPLKALAGRVENGGEKPGLAVPESPVRKSPSEYKLEGRSVSCLKPIEGTLDIALL
SGPHASKTEPSPEPAQSPSPGINVGPSVPPALPGSSGKKGDSASLREPSSANLKVNKSYL
QEPRFLPPSRALQDSLAAPGPDRKSKQERTIIHPSARSTATVTESNRQQKESGPATHQDR
STDTKVLPGPGQTLHNADPPRLCTRAPLPPEAASKEKPCLKEPSAKVKSEWSAIRNDGHR
DPCVKLCPAEAGKVSDSSKPLPSGGRTHPDFYKQTQTSEKAWACAKTNHKDSQDEVKSLA
REDSLHSASLLYEKEVGQARKGPEPKPEVPATRCPSQPPGIEGEKSEKLSAAPSLQKQAP
KEPDRKEQALQRSGGGGPQQPPSTKELANSAAWQHSSSPSHPLKKEPGTKAAAAEASISL
QDTPRSATTTTTAIATATTSAGHSDCSSHKSRPGPDPSPSKAKHQDRPLSSQKLSAGSAK
GKEPVSQPIGGSVREGKGGSKGQSDTFSAIPATQGKASDVLDQGEGRVTIILHTEESLLD
AKLKATNGGGPPEMQEKHLPRQGHPGLSEAADQKLLAAGEKQSLSPKHPKPSTVKDYPGL
CRQTDKSPGQQATIGDRKAEGKKCTEALYVPAPEGYKLEASPSFHHGESGLKGAERPAVG
MGKGFSESKGKGPCPQKPPAEAVKPGGMKRSPSATVQSSLRSAAPPEKSLSYSASFPEAQ
PGVREVTAASSSPSSAKAAVGTSEGPAPSSRDHRKSGGDSRNQMIKSDSLPSFRLSNSTL
ESHFQDPQVPSMAGHRDRALSVTAATGEPKGRELTQPPPVRKQNVGKDVTRAPPVPSADR
SLPLSSEKDVVVRQRRGKESLRSSPQKKAS
Download sequence
Identical sequences ENSRNOP00000057748 10116.ENSRNOP00000057748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]