SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000057876 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000057876
Domain Number 1 Region: 2144-2440
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.52e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000015
Further Details:      
 
Domain Number 2 Region: 658-766
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-33
Family Second domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 1342-1447
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-28
Family PDZ domain 0.0000404
Further Details:      
 
Domain Number 4 Region: 768-874
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-27
Family Third domain of FERM 0.0027
Further Details:      
 
Domain Number 5 Region: 1065-1175
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-27
Family PDZ domain 0.0088
Further Details:      
 
Domain Number 6 Region: 1760-1849
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-21
Family PDZ domain 0.013
Further Details:      
 
Domain Number 7 Region: 1478-1584
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-20
Family PDZ domain 0.05
Further Details:      
 
Domain Number 8 Region: 1853-1944
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-18
Family PDZ domain 0.01
Further Details:      
 
Domain Number 9 Region: 566-657
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000012
Family First domain of FERM 0.017
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000057876
Domain Number - Region: 2-151
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00441
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000057876   Gene: ENSRNOG00000002061   Transcript: ENSRNOT00000061162
Sequence length 2455
Comment pep:known chromosome:RGSC3.4:14:7298778:7433464:-1 gene:ENSRNOG00000002061 transcript:ENSRNOT00000061162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQEVFRRVSIADPAALGFIISPWSLLLLP
SGSVSFTDENVCSQDLRAFTAPEVLQSHSLTSLSDVEKVHIYSLGMTLYWGADHEVPQSQ
PIKLGDHLNSILLGMCEDVLYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGNI
SGTDPLSHSSEEKPDRSQAIRDRLRGKGLPIGRSSTSDALDTHKAPLSQQTFLNKGLSKS
MGFLSVRDTQEEEDYSKEIPSDNNSRHEDSEPFSSPYQFKTSSPHIDVLSKKKTWASSMD
LLCAADRDLSGEIGRYQHCDPETGTGRTSITSRKKEGRYSDGSIALDVFGPQKAEPVIHS
RELPASSAVSSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHSDLFSTSSESPSIISSD
SDFRQVRKSEASKRFESSSGLPGVDDTVQSRPSRQYETSLEGSLINQEMMLRRQEEEMMQ
LQARMALRQSRLSLYPGDTIKTSMLDISRDPLREMALETAMTQRKLRNFFGPEFVKTTVE
PFASLDLPRSILLQTKKGKSEEQRKKVNIMLLSGQRLELTCDTKTVCRDVFDMVVAHIGL
VEHHLFALATLKENEYFFVDPDLKLTKVAPEGWKEEPKRKGKAAVDFTLFFRIKFFMDDV
SLIQHSLTCHQYYLQLRKDLLEERIHCDDEASLLLASLALQAEYGDYQPEVHGLSYFRLE
HYLPARVMEKLDMSYIKEELPKLHNTYAGASEKETELEFLKVCQRLTEYGVHFHRVHPEK
KSQTGILLGVCSKGVLVFEVHNGVRALVLRFPWRETKKISFSKKKITLQNTSDGIKHAFQ
TDSSKACQYLLQLCSSQHKFQLQMRARQSNQDAQDLERASFRSLNLQAESVRGFNVGRAI
STGSLASSTFNKLAVRPLSVQAEILKRLSCSEWSLYQPLQNSSKEKNDKASWEEKPRGMS
KSYHDLSQASLCPHRKQVINMESLPQAFAELVGKPLYPMARSDTESLAGLPQLNNSKSVA
SLNRSPERRSHESDSSVEDPGQAYVVGMSLPSSGKSSSQVPFKDNDSLHKRWSTVSSPER
EITLVNLKKDLKHGLGFQIVGGGKMGRLDLGVFISAVTPGGPADLDGCLKPGDRLISVNS
VSLEGVSHHAAVDILQNAPEDVTLVISQPKEKPTKVPSTPVHFANGMKNYTKKPSSMQDS
AMDPSEDQPWPRGPLRHVPESPFGLSSGLREGSLSSQDSRTESASLSQSHVNGFFTSHLG
DRGWQEPQHSSPSPPVTSKITEKTFSDSYRSPARRQGTCDVTELPGCADSDIDDPTYSSS
QDRQAPKQEPSSPLKASDKMSFAAFPGPSPEPGDAFEVELAKTDGSLGISVTGGVNTSVR
HGGIYVKAVIPNGAAETDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEK
GQSPTSRERDPASPRCPTPDQDAQSQAPEKMEKQTAHVKDYSFVTEDNTFEVKLFKNSSG
LGFSFSREDNLTPELINGSIVRVKKLFPGQPAAESGKINVGDVILKVNGAPLKGLSQQDV
ISALRGTAPEVSLLLCRPAPGVLPEVNTALLTPLHSPAHAFLNSRKEHSQPSPLSVEQCA
SSDENGLSGQSKRQCKPPSRRESYSDHSDSGEEESVRAAAKMPNVIPLSAFAPEALRSQG
EPASTMFYLPRKIPGKPESESSRLPHPLDVSPGQIRQPPAECAPSDSPGKHLTHLASQLH
KEENMTALKNDLGNHLEDSELEVELLITLVKSEKGSLGFTVTKGSQSIGCYVHDVIQDPA
KGDGRLRPGDRLVKVNDADVTNMTHTDAVNLLRAAPKTVRLVIGRILELPRMPVFPHLLP
DITVTCHGEELGFSLSGGRGSPHGVVYISDINPRSAAAVDCSLQLLDIIHYVNGVSTHGM
TLEEANRALDLSLPSVVLKVTRDGCPVVPCSTRSAISALRPLEANGLSSMEPYGQPALTP
KKSFSKVNGDGASGAMCPGGKGLSSPRKKSADLMEARESDSRDDDVYDDPQEAEVIQSLL
DVVDEEAQNLLNQTKASRRACSPDPLRTNGEASEDGEDTDCDGSPLPEDVPESVNGGGGK
ACFASLIQASQEEKPVKEEATQESRESTTETTDREDSSKDPLFLTNEELAALPVVRVPPS
GKYTGTQLQATIRTLQGLLDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRYKNILPY
DTTRVPLGDEGGYINASFIRIPVGTQEFVYIACQGPLPTTVGDFWQMVWEQNSTVIAMMT
QEVEGEKIKCQRYWPSILGTTTMANERLRLALLRMQQLKGFVVRVMALEDIQTGEVRHIS
HLNFTAWPDHDTPSHPEDLLTFISYMRHIRRSGPVITHCSAGIGRSGTLICIDVVLGLIS
QDLEFDISDLVRCMRLQRHGMVQTEGQYVFCYQVVLYVLTHLQAEEQKAQPGLPQ
Download sequence
Identical sequences G3V9S3
ENSRNOP00000057876 NP_001094259.1.100692 NP_001094259.1.4139 10116.ENSRNOP00000057876 ENSRNOP00000057876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]