SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000058913 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000058913
Domain Number 1 Region: 323-490
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-35
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000519
Family SAM (sterile alpha motif) domain 0.000043
Further Details:      
 
Domain Number 3 Region: 179-285
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000396
Family PDZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000058913   Gene: ENSRNOG00000022838   Transcript: ENSRNOT00000067110
Sequence length 704
Comment pep:known chromosome:RGSC3.4:5:152972553:152983208:-1 gene:ENSRNOG00000022838 transcript:ENSRNOT00000067110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVETWTPGKVAAWLRGLDDVLQDYPFEDWELPGKYLLQLCPQNLEALTVWPLGHQELI
LHGVEQLRALGSKLQTENLKSLAQGLLDRTQAFQSLVQGRLRDCAETPADVLNAAVELVR
EAHALLSWLNRYLFTHLNDFSACQEIGVLCGELGQVLQEDCLEAEKESNTLRICGRVAGI
CHNILGCSPEELLEQRAVLELVQLDDPSGLEIHTTSNCLHFVSRVGVQAATGSQILPGDE
IIQINEQVVVGWPHKNMLRELLREPARVSLVLKKIPVPETPSKTPPDSPQRLSQSLPLNP
PSPRVPREGLFDFNLSTDGNPSPSPAWTDSTSLDAQPTPTPPGPPGTLPEETAEPLEASG
HLDKSPTVGRKNSKGIATRLSRRRVSCRELGLPDCDGWLLLRKVPGGFMGARWRRCWFVL
KGHTLYWYRQPQDEKAEGLINISNYSLECGHDQKKKYVFQLTHDVYKPFIFAAETLSDLS
MWVRHLVTCISKYQTLGRAPSAREEDCYSETEAEDPDEEAGSRSASPGPAQAWNDTSPSA
SPLQSPRTSFGSSLDSSDRALEGMVQGLRQGGVSLLGQPQPLTHEQWRSSFMRRNRDPHL
NEHVHRVRALQSTLKAKLQELQVLEEVLGDPELTGAKFRQWKEQNHELYSEGLRTWGGMW
AQTSSPDPNTDSRGQSPQPLPSDPEEPSQLFPSTPENSLQPPDL
Download sequence
Identical sequences G3V8W8
ENSRNOP00000058913 10116.ENSRNOP00000029346 ENSRNOP00000029346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]