SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000058914 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000058914
Domain Number 1 Region: 37-395
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.5e-116
Family Cystathionine synthase-like 0.0000000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000058914   Gene: ENSRNOG00000010658   Transcript: ENSRNOT00000067843
Sequence length 398
Comment pep:known chromosome:RGSC3.4:2:256056562:256082252:-1 gene:ENSRNOG00000010658 transcript:ENSRNOT00000067843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKDASSSGFLPSFQHFATQAIHVGQEPEQWSSRAVVLPISLATTFKQDSPGQSSGFVYS
RSGNPTRNCLEKAVAALDGAKHCLTFASGLAATTTITHLLKAGDEVICMDEVYGGTNRYF
RRVASEFGLKISFVDCSKTKLLEAAITPQTKLVWIETPTNPTLKLADIKACAQIVHKHKD
IILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLVSVNSDDLNERLRFLQN
SLGAVPSPFDCYLCCRGLKTLQIRMEKHFRNGMAVARFLESNPRVEKVIYPGLPSHPQHE
LAKRQCTGCPGMVSFYIKGTLQHAQVFLKNIKLFALAESLGGYESLAELPAIMTHASVPE
KDRATLGISDTLIRLSVGLEDEKDLLEDLGQALKAAHP
Download sequence
Identical sequences Q9EQS4
ENSRNOP00000058914 ENSRNOP00000058914 XP_008759796.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]