SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059068 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059068
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.14e-23
Family PDZ domain 0.00000821
Further Details:      
 
Domain Number 2 Region: 484-586
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-23
Family PDZ domain 0.008
Further Details:      
 
Domain Number 3 Region: 267-376
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-18
Family PDZ domain 0.033
Further Details:      
 
Domain Number 4 Region: 756-866
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000478
Family Nucleotide and nucleoside kinases 0.0012
Further Details:      
 
Domain Number 5 Region: 587-656
Classification Level Classification E-value
Superfamily SH3-domain 0.000000408
Family SH3-domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059068   Gene: ENSRNOG00000015030   Transcript: ENSRNOT00000064578
Sequence length 1167
Comment pep:known chromosome:RGSC3.4:1:227476278:227574457:-1 gene:ENSRNOG00000015030 transcript:ENSRNOT00000064578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQEND
RVVMVNGTPMEDVLHSFAVQQLRKSGKIAAIVVKRPRKVQVAPLQGSPPLSHDDRGFEMM
DEFDGRSFRSGYSERSRHSSHDMLSHSWEDSRERGRPHQRAQSRERERSRGRSLERGLDH
EDYGRSHERSRGRSLERGLDRDFVSRDYSRGRSIDRDYDRDYERSYHQAYEPDYEGRYSP
SYDRRAHPETRYERSRSREHLRSRSPTPESRSRQEHKGQHDPDRPIGVLLTKSKANEEYG
LRLGSQIFIKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLV
VLRDSKQTLINIPSLNDSDSEVEDISEIESNRSFSPEERRQQYSDQEYHSSTEKLKERPS
SREETSGRMSRMGATPTPFKSTGDITAAGVTEANKEPRSQEESPVPQPRTASRVFLRPSP
EDEAIYGPNTKMVKFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNT
QDFRGLVREDAVLYLLEIPKGETVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETP
QSLAFTRGEVFRVVDTLYDGKLGHWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRENAG
DRADFWRMRGQRSGVKKNIRKSREDLAAAVSVSTKFPAYEKVLLREAGFKRPVVLFGPIA
DIAMERLTTELPDLFQTAKTEPKDAGSEKSSGVVRLNTVRQIIEQDKHALLDVTPKAVDL
LNYTQWFPIVIFFNPDSRQGIKTIRQRLNPTSNKSSRKLFDQANKLKKTCSHLFTATINV
NSANDGWFGSLKDSIQQQQNEAVWVSEGKMEGMDDDAEDRMSYLTAHGCGLSLCHPVSSV
TLEDTDGGGPSTDNELDEPAEDPLVYSITRSSEPVQHEESIRKPSPEPRAQMRRAASRDQ
LRDGSPPPAFKPEPPKVCGREAQDVFLFSIHNLIFGPGSYPPVGSLSGWLHCPPLAVKPA
FGRSILKPSTPVPMPESEEVGESTEEQEEAPKSVLGRVKIFEKMDHKAKLQRMQELQEAQ
NARIEIAQKHPDIYAVPIKAPKPDAGLPQHMSSRPPEPQKAPSRLYQDTRGSYGSDPEEE
EEYRQQLAAHSKRGYYSQPSRYRDTEL
Download sequence
Identical sequences ENSRNOP00000059068 10116.ENSRNOP00000059068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]