SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059411 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059411
Domain Number 1 Region: 1064-1146
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 1150-1237
Classification Level Classification E-value
Superfamily Immunoglobulin 5.85e-19
Family I set domains 0.034
Further Details:      
 
Domain Number 3 Region: 766-825
Classification Level Classification E-value
Superfamily BPTI-like 1.28e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0026
Further Details:      
 
Domain Number 4 Region: 308-362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000445
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 926-1006
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000764
Family I set domains 0.035
Further Details:      
 
Domain Number 6 Region: 29-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000017
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 7 Region: 387-448
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000222
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 509-562
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000314
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 9 Region: 447-504
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059411   Gene: ENSRNOG00000009448   Transcript: ENSRNOT00000066621
Sequence length 1296
Comment pep:known chromosome:RGSC3.4:6:107805057:107835170:1 gene:ENSRNOG00000009448 transcript:ENSRNOT00000066621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLLLLLSLLLLLASTPGSWAQNVRRQSDTWGAWGEWSPCSRTCGGGISFRERPCYSQRR
DGGASCVGPARSHRTCHTESCPDSVRDFRAEQCAEFDGTDFQGRRYRWLPYYAAPNKCEL
NCIPKGQNFYFKHRDAVVDGTPCEPGKRDICVEGVCRVVGCDHKLDSTKQEDKCLQCGGD
GSSCYPITGTFDANDLSRGYNQIFIIPAGATSIHIEEADASRNFLAVKSIRGEYYLNGHW
TIEEAQALPVASTVLQYERGVEGDLAPERLQARGPTSEPLVIELIIQESNPGVHYEYYLP
VNDPGRSFSWSYGSWGDCSAECGGGHQSRLVFCTIDNEAYPDHMCQHQPRPAHRRSCNTH
PCPKTKRISFLHRPGAWRYGGAQHVCGNSWKVGPWTPCSVSCGGGFQSRSVYCVSSDGTG
GQEAAEETQCAGLAGKPPTTQACNLQRCAVWSVEPWGECSVTCGAGIRKRSVTCRGDEDS
LVHPAACSLKDQPTLTEPCVREACPGFRGQAWHVGSWSLCSKSCGSGIRRRQVVCTIGPP
GRCVDLQSSKPAEVEACNRQPCHLPQEVPSIQDSRTHPSDRRMLSGPQVSPVADARDQQW
ATLERPRAQSNPREGQDSHLSSAGRAPTLQHPPHQPPLRPSSGARDCRHSPHGCCPDGHT
PSLGPQWQGCPLAGASCLKSRYGCCPDGVSAAKGPQQAGCTRSHSSDNTGNRPGSRAVVS
KDPKIHQSQAHPSEISECRSSQFGCCYDNVAFAAGPLGEGCVGQPSYAYPVRCLLPSAQG
SCGDWAARWYFVGSVGRCNRFWYGGCHGNANNFATEQECMDTCRGQHGPRRPEAGAAGHR
VHMDGGQRGPGGQQEPDWHRIEATVPRLPSPSGSPWSREQEPGPGQAPHIPAQGKRPRVP
GLDRDARPPVRPTHSPSYRINLADSEPSLVQAAPGQAVQLFCPGNIPPEFQAGWQKEGRP
ISSNRYQLQADGSLIISPLRPEDAGIYSCGSQRSGHEPQKIQLRVTGGDMAVLSEVQPRH
FPETRNPDPGHSPQNRGIGVGAEGHRVLSSSHPRPATRLRLDRTQPGVIDASPGQQIQLT
CHAEGFPVPTIEWQRDGQLVSSPRHQVQHDGSLVISRVTVEDGGFYTCVAFNGHDRDQRW
VQLRVQRELTITGLPPAMTVPEGDTARLLCVVAGDSVNIRWSRNGLPIQADGHRVHQSPD
GTLLIHNLRPRDEGSYTCSAFRGSQAVSRSTEVKVALPAPAAQSRDLGKDCIDQPELANC
ALILQAQLCGNEYYSSFCCASCSRFQPNAQPGWQQG
Download sequence
Identical sequences 10116.ENSRNOP00000059411 ENSRNOP00000059411 ENSRNOP00000059411 NYSGRC-IgSF-ENSRNOP00000059411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]