SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059589 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059589
Domain Number 1 Region: 518-871
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-86
Family Protein kinases, catalytic subunit 0.00000167
Further Details:      
 
Domain Number 2 Region: 333-433
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 8.11e-45
Family MAST3 pre-PK domain-like 0.0000145
Further Details:      
 
Domain Number 3 Region: 1105-1197
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-17
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059589   Gene: ENSRNOG00000000147   Transcript: ENSRNOT00000068320
Sequence length 1795
Comment pep:known chromosome:RGSC3.4:5:136573571:136717391:-1 gene:ENSRNOG00000000147 transcript:ENSRNOT00000068320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRRRCRERPQPPPARREDAAPRAAELPQPQSLPPRRRAPPGRQLLEERSGPMGHDSREQ
DMVSGLSPLLFRKLSNPDIFSPTGKAKLQRQLSQDDCKLRRGSLASSLSGKQLLPLSSSV
HSSVGQVTWQSTGEASNLVRMRNQSLGQSAPSLTAGLKELSLPRRGSFCRTSNRKSLIVT
SSTSPTLPRPHSPLHGHTGNSPLDSPRNFSPNAPAHFSFVPARSHGHRADRTDGRRWSLA
SLPSSGYGTNTPSSTVSSSCSSQEKLHQLPFQPTADELHFLTKHFSTENVPDEEGRQSPA
MRPRSRSLSPGRSPVSFDSEIIMMNHVYKERFPKATAQMEERLAEFISCNTPDSVLPLAD
GALSFIHHQVIEMARDCLDKSRSGLITSHYFYELQENLEKLLQDAHERSESSDVAFVIQL
VKKLMIIIARPARLLECLEFDPEEFYHLLEAAEGHAKEGHGIKCDIPRYIVSQLGLTRDP
LEEMVQLSSYDSPDTPETDDSVEGRGASQPSKKTPSEEDFETIKLISNGAYGAVFLVRHK
STRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMFCSFETKRHLCMVMEYV
EGGDCATLLKNIGALPVDMVRLYFAETVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLT
DFGLSKIGLMSLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMG
IILYEFLVGCVPFFGDTPEELFGQVISDEIVWPEGDDALPPDAQDLTSKLLHQNPLERLG
TSSAYEVKQHPFFMGLDWTGLLRQKAEFIPQLESEDDTSYFDTRSERYHHVDSEDEEEVS
EDGCLEIRQFSSCSPRFSKVYSSMERLSLLEGHRTPPPTKRSLSEEKEDHSDGLAGLKGR
DRSWVIGSPEILRKRLSVSESSHTESDSSPPMTVRHRSGLPDVPRCAEETSSTPRKQQQE
GIWVLTPPSGEGSSRPVPERPLERQLKLDEEPPGQSSRSCPAMETRGRGTPQLAEEATAK
AISDLAVRRARHRLLSGDSIEKRTTRPVNKVIKSASATALSLLIPSEHHACSPLASPMSP
HSQSSNPSSRDSSPSRDFLPALGSLRPPIIIHRAGKKYGFTLRAIRVYMGDSDVYTVHHM
VWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELVLKSGNKVSISTTPLENTSI
KVGPARKGSSKAKMARRSKRSRGKDGQESRKRNSLFRKITKQASLLHTSRSLSSLNRSLS
SGESGPCSPTHSHSLSPRSPPQGYRVAPDTVHSGGNSSQSSSPSSSVPSSPAGSGHTRPS
SLHGLAPKLQRQYRSPRRKSAGSIPLSPLAHTPSPPAAAASPQRSPSPLSGHGSQSFPTK
LHLSPPLGRQLSRPKSAEPPRSPLLKRVQSAEKLAAALAAAEKKLAPSRKHSLDLPHGEL
KKELTPREANPLEVVGTRSVLSGKGPLPGKGVLQPAPSRALGTLRQDRAERRESLQKQEA
IREVDSSEDDTDEEPENSQATQEPRLSPHPEASQNLLPKGSGEGREEDTFLHRDLKNRGP
VLSGLLTGNRIEVPGLSQRKLWRPQAFEEATNSLQAPSLSRSGPTSPTPSEGCWEARQLH
TQALATLHPSSSELTPTSCSAATSTSGKPGTWSWKFLIEGPDRASTNKKITRTGEPANSQ
DLETTVPTQVPKNLSPEEEKPQPPSVRGLTHPLLEVPSQNWLWESGCEQMEKEDPSLSIT
EVPGSSGNRRQDIPCRAHHLSPETRPSLLWRSQELGGQQEHQDLALTSDELLKQT
Download sequence
Identical sequences 10116.ENSRNOP00000059589 ENSRNOP00000059589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]