SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059592 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059592
Domain Number 1 Region: 1967-2067
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-30
Family PDZ domain 0.0000859
Further Details:      
 
Domain Number 2 Region: 1599-1713
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-27
Family PDZ domain 0.014
Further Details:      
 
Domain Number 3 Region: 353-471
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-25
Family PDZ domain 0.0033
Further Details:      
 
Domain Number 4 Region: 233-342
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-25
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 1144-1244
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-25
Family PDZ domain 0.0000169
Further Details:      
 
Domain Number 6 Region: 1720-1805
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-24
Family PDZ domain 0.0052
Further Details:      
 
Domain Number 7 Region: 1851-1949
Classification Level Classification E-value
Superfamily PDZ domain-like 1.16e-23
Family PDZ domain 0.0066
Further Details:      
 
Domain Number 8 Region: 129-231
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-23
Family PDZ domain 0.0039
Further Details:      
 
Domain Number 9 Region: 682-778
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-23
Family PDZ domain 0.0047
Further Details:      
 
Domain Number 10 Region: 1340-1435
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-21
Family PDZ domain 0.035
Further Details:      
 
Domain Number 11 Region: 4-63
Classification Level Classification E-value
Superfamily L27 domain 9.42e-20
Family L27 domain 0.00062
Further Details:      
 
Domain Number 12 Region: 1470-1563
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-19
Family PDZ domain 0.0092
Further Details:      
 
Domain Number 13 Region: 539-629
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-18
Family PDZ domain 0.033
Further Details:      
 
Domain Number 14 Region: 978-1073
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-18
Family PDZ domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059592   Gene: ENSRNOG00000007894   Transcript: ENSRNOT00000064897
Sequence length 2068
Comment pep:known chromosome:RGSC3.4:5:100008987:100170202:-1 gene:ENSRNOG00000007894 transcript:ENSRNOT00000064897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLETIDKNRALQAAERLQSKLKERGDVANEDKLSLLKSVLQSPLFSQILSLQTSLQQLKD
QVNVATLATANADHAHTPQFSSAIISNLQSESLLLSPSNGNLEAISGPGAPPAMDGKPAC
EELDQLIKSMAQGRHVEIFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRD
GRLKETDQILAINGQVLDQTITHQQAISILQKAKDTIQLVIARGSLPHISSPRISRSPSA
ASTVSAHSNPTHWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSG
DHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPAPSSLGITLSSSTSTSE
MRVDASTQKNEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVELDG
RIQIGDQIVAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAEITSREDTAKDV
DLPAENYEKDEESLSLKRSTSILPIEEEGYPLLSTELEETEDVQQEAALLTKWQRIMGIN
YEIVVAHVSKFSENSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLL
GENHQDVVNILKELPIDVTMVCCRRTVPPTALSEVDSLDIHDLELTEKPHIDLGEFIGSS
ETEDPMLAMSDVDQNAEEIQTPLAMWEAGIQAIELEKGSRGLGFSILDYQDPIDPANTVI
VIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKPLP
LSPEEGYVSAKEDTFLCSPHTCKEMGLSDKALFRADLALIDTPDAESVAESRFESQFSPD
NDSVYSTQASVLSLHDGACSDGMNYGPSLPSSPPKDVTNSSDLVLGLHLSLEELYTQNLL
QRQHAGSPPTDMSPAATSGFTVSDYTPANAVEQKYECANTVAWTPSQLPSGLSTTELAPA
LPAVAPKYLTEQSSLVSDAESVTLQSMSQEAFERTVTIAKGSSSLGMTVSANKDGLGVIV
RSIIHGGAISRDGRIAVGDCILSINEESTISLTNAQARAMLRRHSLIGPDIKFSAAPADD
RAPFYVITYVPAEHLEEFRVSFGQQAGGIMALDIFSSYTGRDIPELPEREEGEGEESELQ
NAAYSSWSQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKN
GTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGSPVVFMVQSIVNRPRKSPLPSLPHSLY
PKCSFSSTNPFAESLQLTSDKAPSQSESESEKATLCSVPSSSPSVFSEMSSDYAQPSATT
VAEDEDKEDEFGYSWKNIQERYGTLTGQLHMIELEKGHSGLGLSLAGNKDRTRMSVFIVG
IDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADAVNQM
AVCPGSAADPLPSTSESPQNKEVEPSITTSASAVDLSSLTNVYHLELPKDQGGLGIAICE
EDTLNGVTIKSLTERGGAAKDGRLKPGDRILAVDDELVAGCPIEKFISLLKTAKTTVKLT
VGAENPGCQAVPSAAVTASGERKDSSQTPAVPAPDLEPIPSTSRSSTPAIFASDPATCPI
IPGCETTIEISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNG
IDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTFTVELQKRPGKGLGLSIVG
KRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLE
VGRIKAAPFHSERRPSQSSQVSESSLSSFSLPRSGIHTSESSESSAKKNALASEIQGLRT
VEIKKGPADALGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTD
GMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSTIFPDDLGP
PQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNG
QSLEGVTHEEAVAILKRTKGTVTLMVLS
Download sequence
Identical sequences A0A0G2K2Y8
10116.ENSRNOP00000059212 XP_006238402.1.100692 ENSRNOP00000059592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]