SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059667 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000059667
Domain Number - Region: 17-72
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000778
Family AAT-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059667   Gene: ENSRNOG00000043426   Transcript: ENSRNOT00000067165
Sequence length 77
Comment pep:known chromosome:RGSC3.4:2:240849379:240857331:1 gene:ENSRNOG00000043426 transcript:ENSRNOT00000067165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVIGVDLSDVKSDEPYDYKFVKWMTKNKKLSAIPVSAFCDSESKPHFEKLVRFCFIKKDS
TLDAAEEIFRTWNSRKS
Download sequence
Identical sequences ENSRNOP00000059667 10116.ENSRNOP00000059667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]