SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059957 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059957
Domain Number 1 Region: 748-824,858-947
Classification Level Classification E-value
Superfamily RUN domain-like 7.19e-36
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1107-1280
Classification Level Classification E-value
Superfamily RUN domain-like 1.96e-26
Family RUN domain 0.014
Further Details:      
 
Domain Number 3 Region: 955-1052
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 9.87e-19
Family Lipoxigenase N-terminal domain 0.035
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000059957
Domain Number - Region: 634-707
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.049
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059957   Gene: ENSRNOG00000012206   Transcript: ENSRNOT00000065409
Sequence length 1287
Comment pep:known chromosome:RGSC3.4:1:167526051:167528011:-1 gene:ENSRNOG00000012206 transcript:ENSRNOT00000065409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGGGGGGSAPSRFADYFVICGLDTETGLEPDELSALCQYIQASKARDGASPFISSTTE
GENFEQTPLRRTFKSKVLARYPENVDWNPFDQDAVGMLCMPKGLAFKTQADPREPQFHAF
IITREDGSRTFGFALTFYEEVTSKQICSAMQTLYHMHNAEYDVLHAPLADGGDQSGMEDG
EGIPGTKLQRFNSYDISRDTLYVSKCICLITPMSFMKACRSVLQQLHQAVTSPQPPPLPL
ESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNELPLFDFPVKEVFELLGVENVFQ
LFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQHVYVPILPASLLHFLDAPVPYL
MGLHSNGLDDRSKLELPQEANLCFVDVDNHFIELPEDLPQFPNKLEFVQEVSEILMAFGV
PPEGNLHCSESASKLKRIRASELVSDKKNGNIAGSPLHSYELLKENETIARLQALVKRTG
VSLEKLEVREDPSSNKDFKVQCDEEELRIYQLNIQIREVFANRFTQMFADYEVFVIQPSQ
DKESWLSNREQMQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDNKIMCHDDDDKDPV
LRVFDSRVDKIRLLNVRTPTLRTSMYQKCTTVDEAEKAIELRLAKIDHTAVHPHLLDMKI
GQGKYEPGFFPKLQSDVLCTGPASNKWTKRNAPAQWRRKDRQKQHTEHLRLDNDQREKYI
QEARNMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVELGHG
EVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHYQENRQRKLTSGSLSTS
GILLDSERRKSDASAVMSPLRVSLIQDMRHIQNIGEIKTDVGKARAWVRLSMEKKLLSRH
LKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTILIPYHILI
VPSKKLGGSMFTANPWICISGELGETQILQIPRNVLEMTFECQNLGKLTTVQIGHDNSGL
YAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERVLVGELLTSLPEVDERPCRTP
PLQQSPSVIRRLVTISPNNKPKLNTGQIQESIGEAVNGIVKHFHKPEKERGSLTLLLCGE
CGLVSALEQAFQHGFKSPRLFKNVFIWDFLEKAQTYYETLEQNDVVPEENWHTRARNFCR
FVTAVNNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLADCPITAHMYEDVALIKDHTLV
NSLIRVLQTLQEFNITLDTSLVKGIDI
Download sequence
Identical sequences G3V7Q0
ENSRNOP00000059957 10116.ENSRNOP00000017485 NP_001101016.2.100692 NP_001101016.2.4139 ENSRNOP00000017485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]