SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060217 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060217
Domain Number 1 Region: 5-367
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.99e-111
Family GABA-aminotransferase-like 0.0000000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060217   Gene: ENSRNOG00000013971   Transcript: ENSRNOT00000065063
Sequence length 370
Comment pep:known chromosome:RGSC3.4:1:219268422:219289685:-1 gene:ENSRNOG00000013971 transcript:ENSRNOT00000065063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATKQVVNFGPGPAKLPYSVLLEIQKQLLDYKGLGISVLEMSHRSPDFAKIISNTENLV
RELLAVPNNYKVIFVQGGGTGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGT
VNIVHPKLGSYTKIPDPSTWNLNPDASYVYFCANETVHGVEFDFIPDVKGAVLVCDMSSN
FLSRPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLDYKVQAGNNSLY
NTPPCFSIYVMDMVLEWIKNNGGAAAMEKLSSVKSQMIYEIIDNSQGFYVCPVERQNRSR
MNIPFRIGNSKGDEALEKRFLDKAVELNMISLKGHRSVGGIRASLYNAVTTEDVEKLAAF
MKNFLEMHQL
Download sequence
Identical sequences 10116.ENSRNOP00000018763 ENSRNOP00000060217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]