SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060257 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060257
Domain Number 1 Region: 187-622
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.04e-72
Family Tandem AAA-ATPase domain 0.018
Further Details:      
 
Domain Number 2 Region: 871-944
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.35e-16
Family AN1-like Zinc finger 0.0026
Further Details:      
 
Domain Number 3 Region: 709-801
Classification Level Classification E-value
Superfamily R3H domain 0.0000000000000124
Family R3H domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060257   Gene: ENSRNOG00000013456   Transcript: ENSRNOT00000066587
Sequence length 988
Comment pep:known chromosome:RGSC3.4:1:205792589:205815408:-1 gene:ENSRNOG00000013456 transcript:ENSRNOT00000066587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSTVESFVAQQLQLLELERDAEVEERRSWQEHSSLKELQSRGVCLLKLQVSGQRTGLY
GQRLVTFEPRKFGPAVVLPSNSFTSGDIVGLYDTNESSQLATGVLTRITQKSVIVAFDES
HDFQLNLDRENTYRLLKLANDVTYKRLKKALLTLKKYHSGPASSLIDVLLGGSTPSPATE
IPPLTFYNTTLDPSQKEAVSFALAQKEVAIIHGPPGTGKTTTVVEIILQAVKQGLKVLCC
APSNIAVDNLVERLALCKKQILRLGHPARLLESVQQHSLDAVLARSDNAQIVADIRRDID
QVFGKNKKTQDKREKSNFRNEIKLLRKELKEREEAAIVQSLSAADVVLATNTGASTDGPL
KLLPEDYFDVVVVDECAQALEASCWIPLLKAPKCILAGDHKQLPPTTVSHKAALAGLSRS
LMERLAEKHGAAVVRMLAVQYRMHQAITRWASEAMYHGQLTAHPSVAGHLLKDLPGVADT
EETSVPLLLIDTAGCGLLELEEEDSQSKGNPGEVRLVTLHIQALVDAGVQAGDIAVIAPY
NLQVDLLRQSLSNKHPELEIKSVDGFQGREKEAVILTFVRSNRKGEVGFLAEDRRINVAV
TRARRHVAVICDSHTVNNHAFLKTLVDYFTEHGEVRTAFEYLDDIVPENYTHEGSRSHSC
APKPKCPTTSVRKPASAQESRQEARAATGHSRRKPSEKPLGSQVQPQHSSKANGSDRTGG
TDRTEHFRAMIEEFVASKEAQLEFPTSLSSHDRLRVHQLAEEFGLKHDSTGEGKARHITV
SRRSPAGSGSATPQPPSPPSPAQAEPEPQVEQPVGQPHGSTQLDLKALHLERLQRQQGCQ
AQSQLGGGSRPQKAPQKKKKKEPKGPAMALPSEEDFDALVSAVVKADNTCSFTKCSASTT
TLGQFCMHCSRRYCLSHHLPEIHGCGEKARAHARQRISREGVLYAGSGTKDRALDPAKRA
QLQRKLDKKLGELSSQRTSKKKEKERGT
Download sequence
Identical sequences ENSRNOP00000060257 10116.ENSRNOP00000018487 ENSRNOP00000018487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]