SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060286 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060286
Domain Number 1 Region: 44-132
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-25
Family PDZ domain 0.0014
Further Details:      
 
Domain Number 2 Region: 126-255
Classification Level Classification E-value
Superfamily PH domain-like 9.32e-21
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 271-400
Classification Level Classification E-value
Superfamily PH domain-like 0.0000511
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060286   Gene: ENSRNOG00000004928   Transcript: ENSRNOT00000066904
Sequence length 518
Comment pep:known chromosome:RGSC3.4:6:48059246:48263991:-1 gene:ENSRNOG00000004928 transcript:ENSRNOT00000066904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARTKTALALLYDEGLENAYDVRLKLTKEVLTIQKQDVVCIGGAPPGANHRTVTLRRQPVG
GLGLSIKGGAEHGVPVVISKIFKDQAADQTEMLFIGDAVLQVNGINVENATHEEVVHLLR
NAGDVVTITVEYLREAPSFLKLPLGSPGPSSDHSSRASSPLFDSGLHLNGHCSHTAPSSP
SSPIANEPKYEKRWLDTLSVPLSMARISRYKAGTEKLRSSALEVLALDGASTGALQFSTA
QDCADWLRAISTNINELTLQHMKMANKCCSPCDQVVHMGWVNERLQGADNNPQNFRSKFL
ALRGSSFYIFSAPPVSTLDWGRAERAYNLCEVLFKVHKFWLSDNYWLQANLYLGLQDLDC
EDPRSYCFSVLASHGKSHIFSVELGNELAVWEKAFQRATFMEVQRTGSKTYLCSWQGEML
CFTVDFALGFTCFDSKTKNVLWRFKFSQLKGSSDDGKTRVKLLFQNPDTKQIETKELEFQ
DLTAVLHCIHSFIAAKVASLDPAFMDSQSVARRYMCSS
Download sequence
Identical sequences 10116.ENSRNOP00000006716 ENSRNOP00000060286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]