SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060330 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060330
Domain Number 1 Region: 1321-1483
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-70
Family Pleckstrin-homology domain (PH domain) 0.00000389
Further Details:      
 
Domain Number 2 Region: 1106-1324
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-53
Family DBL homology domain (DH-domain) 0.0000000949
Further Details:      
 
Domain Number 3 Region: 508-623
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-20
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 4 Region: 908-991
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000118
Family PDZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060330   Gene: ENSRNOG00000016728   Transcript: ENSRNOT00000065386
Sequence length 1717
Comment pep:known chromosome:RGSC3.4:1:38397390:38513591:1 gene:ENSRNOG00000016728 transcript:ENSRNOT00000065386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSESQYTFQGSKNQSNTVTGAKQKPCSLKIRSIHAKDEKSLHGWAHGSGGAGYKSRSL
ARSCLSHFKSHQPYATRLNGPTCKVSKGTAYSKHRANAPGNDFQGNNGAFLPENGFHYVG
RESGESHITSRDCNGHLLTCYGRHDSIASTPPGEDRRSPRVLIKTLGKLDGCLRVEFHNG
GNPHKGPSEDPSEPVQLLRYSPTLAAETCPVPESRRLSGAGSSASQRPSPTDSCLRSSKG
SSLSSESSWYDSPWGNAGEASEVDGTFLAPSALDPSLPSSFPPSDTKKPFNQSSSLSSLR
ELYKDANLGCRSPSGTCLSSNEYISSQVGLNNRVSFASDMDVPSRVDHRDTMQYSSFTLP
CRKSKALTEDAAKKDTLKARMRRFSDWTGSLSRKKRKLQEPRSTEGSEYFDSHSDGLNAD
VQGPTQTSALLWSGGSAQTLPHRSESTHAIGSDPLQQNIYENFMRELEMSRTNMENAETS
TETVESSSESLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTLQKERKLELVARRKWKQYW
VTLKGCTLMFYETYGKNSTDQNSAPRCALFAEDSIVQSVPEHPKKEHVFCLSNSYGDVYL
FQATSQTDLENWITAIHSACASLFAKKHGKEDTVRLLKSQTRGLLQKIDMDSKMKKMAEL
QLSVVSDPKNRKAIENQIRQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRP
SKLALGRLGVLSVSSFHALVCSRDDSALRKRTLSFTQRAKSKKGLFSSLKGLDTLARKGR
EKRASITQMFDSSHSHGYLGTQLPQNSTNSSEVHDLHLYGSSADSTLRDSTWEVQTYVHF
QDNEGVTVIIKPEHRVEDVLALACKMRHLEPTRYGLQLRKVVDESVEWCVPALYEYMQEQ
ASCVYDEIEVFPLSVYDVQLTKTGDMTDFGFAVTAQVDEHQHLSRIFISDVLPDSLAYGG
GLRKGNEIRSLNGEAVSDLDLKQMEALFSEKSVGLTLVARPADTRASLCTSCSDSDLFSR
DQKSLLPSPNQCQLLEEFLDNFKKTSTNVVPNLPNTTTRLHSSQSERVADTGPHEEQFKQ
SFLSAEQIVELCRGTTSMEAPTDSRDPPPRPLARHLSDADRLRKVIQELVDTEKSYVKDL
SCLFELYLEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFSVLETPS
QFRKLLFSLGGSFLYYADHFKLYSGFCANHIKVQKVLERAKTDRAFKAFLDARNPTKQHS
STLESYLIKPVQRVLKYPLLLKELVSLTDHESEEHYHLTEALKAMEKVASHINEMQKIYE
DYGTVFDQLVAEQSGTEKEVTELSMGELLMHSTVSWLNPFLSLGKARKDIELTVFVFKRA
VILVYKENCKLKKKLPSNSRPAHNSADLDPFKFRWLIPISALQVRLGNTAGTENNSTWEL
IHTKSEIEGRPETIFQLCCSDSESKTSIVKVIRSILRENFRRHIKCELPMEKTCKDRLVP
LKNRVPVSAKLASSRSLKVLRTSSSSEWPSDPSKGNSLDSDECSLSSGTQSSGCPVAESR
QDCKSTVLEKDAHEVLAEFPDGLIKESDILSDEEEDFHHPLKQGSPTKDIELQFQRLRIS
EEPDMHSTGQQPPLTGPGEQPKLVRGHFCPIKRKANSTKRGRGTLLKAQTRHQSLDSHPE
TASIDLNLVLEREFSVQSLTSVVNEECFYETQSHGKS
Download sequence
Identical sequences 10116.ENSRNOP00000022567 ENSRNOP00000060330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]